[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cper0:BAB82040.1


[Show Plain Result]

## Summary of Sequence Search
   1::99
  12::96   PF01371 0.0% 47.0588235294118  Trp repressor protein 
   1::99


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNGVQSKLKGKDLDFLFEAILKLEDINECYNFFEDICTISELKALAQRLHVAKMLREKKTYTEIAEETKA
PF01371         -----------eldalvelilkleneeeleellelllTpdErealaqRlrvvkeLLkeelsqreiaeelg


                         -         -         *         -         -         -         -:140
query           STATISRVNRCLNYGADGYNNILNRLDEK-----------------------------------------
PF01371         vSiAtItRgsnsLktgsdeykavLer--------------------------------------------