[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cper0:BAB82239.1


[Show Plain Result]

## Summary of Sequence Search
   1::192
  42::151  PF07670 0.0% 15  Nucleoside recognition 
   1::192


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MINYIWFAIIALGLIFSIMTGQGELITTGLTESSEGAVKFIISLVGIMCFWCGVMKIAENSGLTSKVAKL
PF07670         -----------------------------------------lkagpiillasiliwllsslsllgrigkl


                         -         -         *         -         -         -         -:140
query           LNPILKKIFKESSHSDEAMGAIVMNLTANMFGLSNAATPLGIKAMSELNKINKEKDGRASNDMALFLVIN
PF07670         lepvfapl.gl..dwkasvg.litgllakevvvgtlgtlytlggamlegfltp....reaialllfvlly


                         +         -         -         -         -         *         -:210
query           AACIQLIPSTVISIRAAAGSSEPASIIIPAIICTFTACCVGIICCKILQRYF------------------
PF07670         tpcvatla..v-----------------------------------------------------------