[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cper0:BAB82330.1


[Show Plain Result]

## Summary of Sequence Search
   1::293
  15::277  PF03313 0.0% 41.8604651162791  Serine dehydratase alpha chain 
   1::293


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MIARSGAELLEICRENNFSLAEYAIQYEMESKNCTREDVIKGMEKVLQVMKEAANEGQEKEVYSVSGLIG
PF03313         --------------eeelsiselvlknelavvvpgegevgaklaailgamkgdveagl....evlegilp


                         -         -         *         -         -         -         -:140
query           GDAYKLKKYLEKGDTLTGNVMVGAMARALSCSEVNASMGRIVACPTAGSCGILPAVILTVGERLNLSDEE
PF03313         gdlevarralalnkklaeeglegsygkkaeaevlkedplelldranalalAvseenaaggrvvaaptaGs


                         +         -         -         -         -         *         -:210
query           LIQGLLASSAVGMIIAQNATLAGAEGGCQAECGSAAAMGAAATVEMMGGTPEMALDAGAIVFKNILGLVC
PF03313         agvlPavllal.eeleaseekliraLllahligilikknasilgAecGCqaevGsasaMAAaglvellgg


                         -         -         -         +         -         -         -:280
query           DPIAGLVEVPCAKRNFAGAVSALTTADLVMAGIHSKIPFDDTVEAMYRVGKSLPASLRETALGGLAITKT
PF03313         speqvenAaeialenllGlvCDpvaGlvkipCiernatgavkAinaarlalagvdgkegivldevie---


                         -         *         -         -         -         -         +:350
query           GLKLKEKVFGKDK---------------------------------------------------------
PF03313         ----------------------------------------------------------------------