[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for cper0:BAB82333.1


[Show Plain Result]

## Summary of Sequence Search
   1::241
  95::233  PF07702 0.0% 33.8129496402878  UTRA domain 
  10::73   PF00392 0.0% 51.5625  Bacterial regulatory proteins, gntR family 
  37::74   PF08220 0.0% 36.8421052631579  DeoR-like helix-turn-helix domain 
  36::79   PF01978 0.0% 33.3333333333333  Sugar-specific transcriptional regulator TrmB 
 114::132  PF01978 0.0% 38.8888888888889  Sugar-specific transcriptional regulator TrmB 
  27::70   PF01325 0.0% 34.0909090909091  Iron dependent repressor, N-terminal DNA binding do 
  34::70   PF08279 0.0% 40.5405405405405  HTH domain 
   1::241


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MFKRSRGIALYHQLETELIDLINSGELKENDKLPSERELCEQYNVSRTTARQAIGELERKEYVYKVHGKG
PF07702         ----------------------------------------------------------------------
PF00392         ---------lyeqvyeeLredIlsgelrpGdkLPsereLaaefgVsrttvReALrrLeaeglverrqgrG
PF08220         ------------------------------------eelvellgvSeaTiRRDLneLeeqglltRthGGa
PF01978         -----------------------------------adeiaeelgvprskvyevLrsLekkGlverekgr.
PF01978         -----------------------------------adeiaeelgvprskvyevLrsLekkGlverekgr.
PF01325         --------------------------lseekkvvktkdlAerLnvspstVsemlkkLekdGyveyekykg
PF08279         ---------------------------------vsgeeLAeeLnVSrrtirrdIkaLeelgvpIeskpgr


                         -         -         *         -         -         -         -:140
query           TFISPKVYKQQLLKFYSFTEEMKKLGKNPSSKILSFDLIRADNKISEKLKVEENSLVYKIVRLRIADEVP
PF07702         ------------------------qgrkpktevlsleevpapaelaeaLglppgepvlrieRlryadgep
PF00392         tfV-------------------------------------------------------------------
PF08220         vsis------------------------------------------------------------------
PF01978         ....pklYk----------------------------------eiaeelgvprsk.vyevLr--------
PF01978         ....pklYk----------------------------------eiaeelgvprsk.vyevLr--------
PF01325         ----------------------------------------------------------------------
PF08279         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           MMVECTYLPEYRFIDLKEKMLKEKPMYDIFREVYNVSLTKAKESFKPILISKSDSKLLNVEDGTAAMRIE
PF07702         valeesylpaelvpdlleedleegslyayleeelglritraeetiearlataeeaelLgiepgapvlvie
PF00392         ----------------------------------------------------------------------
PF08220         ----------------------------------------------------------------------
PF01978         ----------------------------------------------------------------------
PF01978         ----------------------------------------------------------------------
PF01325         ----------------------------------------------------------------------
PF08279         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           RVTFENERVIEYTVSVSRGDKFEYTVVLEED---------------------------------------
PF07702         rvtydadgrpveysesyyrgdrf-----------------------------------------------
PF00392         ----------------------------------------------------------------------
PF08220         ----------------------------------------------------------------------
PF01978         ----------------------------------------------------------------------
PF01978         ----------------------------------------------------------------------
PF01325         ----------------------------------------------------------------------
PF08279         ----------------------------------------------------------------------