[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cper0:BAB80017.1


[Show Plain Result]

## Summary of Sequence Search
   1::262
   1::259  5.4e-83 43.1% 0048520 00485201 1/1   ne nucleotide alpha hydrolases-like     
   1::258  1.8e-82 45.2% 0046546 00465461 1/1   ne nucleotide alpha hydrolases-like     
   1::252  1.7e-81 43.8% 0036966 00369661 1/1   ne nucleotide alpha hydrolases-like     
   1::215  5.1e-31 28.2% 0048521 00485211 1/1   ne nucleotide alpha hydrolases-like     
   2::215  9.6e-31 24.6% 0046540 00465401 1/1   ne nucleotide alpha hydrolases-like     
  21::217  6.9e-10 22.3% 0036970 00369701 1/1   ne nucleotide alpha hydrolases-like     
   1::262


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKIMVCIKQVPGTSKVEVDEKTGVLKRDGVDSKMNPYDLYALETALRIKEKKGGNIKVISMGPPQAKAVI
00485201   1/1  mkilVcvkqvpdtnvkvrvdpkgvtvdregvkgiinpvdlealeeAlrlkeklggalevtvvsvGppeae
00465461   1/1  mkilVcvkqvpdtnvkvrvdpdgvtvdregvklvinpfdlialeeAlrlkekllggevtvvsvGppeaee
00369661   1/1  mkilVlvkqvpdtevkvridpvdgtldregvkliinpfdeiAleeAlrlkeklggtevtvvsvGppeaee
00485211   1/1  mkvlVlaehvng....................klnpvslellgaArrlaeklggevvavvigsg.aeela
00465401   1/1  -svlVlaehvng....................klnpvtlelltaArel....ggevtvlvlgpgvaaval
00369701   1/1  --------------------ksvlVlaEhrdgelkpvslellgaArkl....ggevtvvviGsgvdelae


                         -         -         *         -         -         -         -:140
query           KEAYSMGADEGTLVSDRKFAGADVLATSYTLSQGVKKCGDFDIILCGKQTTDGDTAQVGPEMAEYLGIPH
00485201   1/1  ealrealamGadrailveddalagadtlatakaLaaaikklg.pdlvllGkqaidgdtgqvgpllAallg
00465461   1/1  alrealamGadrailvsddaledagadplatakaLaaaikklg.pdlvllGkqaidgdtgqvgpllAell
00369661   1/1  alrealamGadrailvevsddalagadtlatakaLaavikklg.pdlvllGkqaiDgdtgqvgpllAall
00485211   1/1  eealaygadkvllvdddala.ylaeayakalaalikke.kpdlvllgatalgkd...laprvAallgagl
00465401   1/1  eealaygadkvlvadddalagylaeayaaalaalik...dpdlvlagatalgkd...laPrvAalldvgl
00369701   1/1  elakyaGadkvlvaddpalegylaeayakalaalikklg.pdivlagataigkd...laPrvAarldvgl


                         +         -         -         -         -         *         -:210
query           VANVRRILDVNDDFIKVEMDMPNTIEVLEVKYPCLLTVDKDIFQPRLPSYKKKLETDEREINVISLNDFE
00485201   1/1  lplvtdvtkl.eidleggkllvtreleggllevvevslPavvtvrpglneprypslkgimkakkkpievl
00465461   1/1  glplvtdvskl.evdggkllvtrelegglevvevslPavvtvrkglneprypslkgimkakkkpievlsl
00369661   1/1  glplitlvskl.evdggkllvtrelegglevvelklPavvtvdlglnepRypslpnimkakkkplevlsl
00485211   1/1  vsdvtelev.ddgkltvtRpiyggnalatvklpdsrpavlTvrpgafepaeaggsaiveavevplddlrt
00465401   1/1  isdvtele.vdltftrpiyggnaiatvkstdrpavvTvrpgafepaaeggsgaveavkveldellsevlg
00369701   1/1  vsdvtal.evddtftrpiygGnaiatvksadgpkvaTvrpgafeaaeadggsaevelvaavadadlsefv


                         -         -         -         +         -         -         -:280
query           DKDEKKYGLNGSPTQVERIFPPSNNDDHEIWTGDSSELSERMEDKLRELKFI------------------
00485201   1/1  slddl.gvdlevvglagspvkllkaevpvsrgrg.ikvgdvlelaeeLa---------------------
00465461   1/1  adlgldl.......gsptkvlkaeipvargrg.ikvgdvlelaekLae----------------------
00369661   1/1  adlgldl.......gsptkvlkvfepekrragiiieg.vdel----------------------------
00485211   1/1  kvlgv-----------------------------------------------------------------
00465401   1/1  velke-----------------------------------------------------------------
00369701   1/1  eeelrks---------------------------------------------------------------