[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cper0:BAB80033.1


[Show Plain Result]

## Summary of Sequence Search
   1::171
   1::155  2.4e-51 43.2% 0044504 00445041 1/1   e/Galactose isomerase RpiB/AlsB         
   1::144  2.6e-44 46.4% 0041667 00416671 1/1   e/Galactose isomerase RpiB/AlsB         
   1::146  5.1e-44 45.5% 0041466 00414661 1/1   e/Galactose isomerase RpiB/AlsB         
   1::171


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKIAIGCDHIVTDTKIAVSDFLKAKGYDVLDVGTYDFTRTHYPIFGKKVGEAVASGEADLGVCICGTGVG
00445041   1/1  lmkiaigsdhaglelkelllelLkekgyevidlGtlsedasvdYpdlalavaeavasgeadlgilicgtG
00416671   1/1  llmkiaigsdhaglelkelllelLkekgyevidlGtlsdesvdYpdlalavaeavasgeadlgilicgtG
00414661   1/1  eleeelleeelellmkiaigsdhaglelkellleyLeekgyevidlGtlsdesvdYpdlalavaeavasg


                         -         -         *         -         -         -         -:140
query           INNAVNKVPGIRSALVRDMTTAIYAKEQLNANVIGFGGKITGEFLMCDIIEAFIKADYIENEENKKIINK
00445041   1/1  iGvsiaankvkgirAAlvldelsAllarehnnanvlalgarvvglelalnivdafletefseggrharrv
00416671   1/1  iGvsiaankvkgirAAlvldelsAllarehnnanvlalggrvvglelaleivdafletefeg.grhaerv
00414661   1/1  eadlgilicgtGiGvsiaankvkgirAAlvldelsAllarehnnanvlalggrvvglelaleivdaflet


                         +         -         -         -         -         *         -:210
query           INSLEENKPEQNDIHFFDEFLERWNRGEYKD---------------------------------------
00445041   1/1  dkiselenaglleel-------------------------------------------------------
00416671   1/1  dkld------------------------------------------------------------------
00414661   1/1  efeg.g----------------------------------------------------------------