[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cper0:BAB80140.1


[Show Plain Result]

## Summary of Sequence Search
   1::162
  29::161    6e-14 23.2% 0050940 00509401 1/1   CoA N-acyltransferases (Nat)            
  30::161  1.1e-13 24.4% 0049032 00490321 1/1   CoA N-acyltransferases (Nat)            
  27::161  2.7e-13 22.2% 0051493 00514931 1/1   CoA N-acyltransferases (Nat)            
  26::161  7.5e-13 26.5% 0052829 00528291 1/1   CoA N-acyltransferases (Nat)            
  26::161  9.4e-13 25.4% 0052858 00528581 1/1   CoA N-acyltransferases (Nat)            
  35::161  9.8e-13 27.5% 0052040 00520401 1/1   CoA N-acyltransferases (Nat)            
  24::164  1.2e-12 23.7% 0046158 00461581 1/1   CoA N-acyltransferases (Nat)            
  25::161  1.7e-12 24.4% 0047280 00472801 1/1   CoA N-acyltransferases (Nat)            
  26::161  2.2e-12 24.8% 0048674 00486741 1/1   CoA N-acyltransferases (Nat)            
  39::161  2.6e-12 27.8% 0051420 00514201 1/1   CoA N-acyltransferases (Nat)            
  25::161  2.7e-12 22.0% 0051751 00517511 1/1   CoA N-acyltransferases (Nat)            
  23::161    3e-12 22.6% 0046177 00461771 1/1   CoA N-acyltransferases (Nat)            
  26::161  3.5e-12 23.3% 0051252 00512521 1/1   CoA N-acyltransferases (Nat)            
  27::161  3.6e-12 23.4% 0052713 00527131 1/1   CoA N-acyltransferases (Nat)            
  28::164  4.5e-12 25.4% 0050185 00501851 1/1   CoA N-acyltransferases (Nat)            
  28::161  7.8e-12 22.7% 0051915 00519151 1/1   CoA N-acyltransferases (Nat)            
  29::161  1.3e-11 22.5% 0048876 00488761 1/1   CoA N-acyltransferases (Nat)            
  27::160  1.4e-11 26.6% 0049031 00490311 1/1   CoA N-acyltransferases (Nat)            
  29::161  1.8e-11 25.9% 0051248 00512481 1/1   CoA N-acyltransferases (Nat)            
  20::164  1.9e-11 24.5% 0051377 00513771 1/1   CoA N-acyltransferases (Nat)            
  30::163  1.9e-11 23.8% 0051303 00513031 1/1   CoA N-acyltransferases (Nat)            
  19::164  2.2e-11 22.5% 0048084 00480841 1/1   CoA N-acyltransferases (Nat)            
  33::161  2.5e-11 24.8% 0051437 00514371 1/1   CoA N-acyltransferases (Nat)            
  28::161  3.2e-11 26.7% 0049641 00496411 1/1   CoA N-acyltransferases (Nat)            
  26::161  3.3e-11 25.4% 0050733 00507331 1/1   CoA N-acyltransferases (Nat)            
  76::161  4.5e-11 33.3% 0049804 00498041 1/1   CoA N-acyltransferases (Nat)            
  27::161  4.8e-11 25.8% 0050223 00502231 1/1   CoA N-acyltransferases (Nat)            
  28::161    5e-11 28.6% 0051830 00518301 1/1   CoA N-acyltransferases (Nat)            
  26::161  5.7e-11 24.4% 0052704 00527041 1/1   CoA N-acyltransferases (Nat)            
  29::161  8.4e-11 27.6% 0048174 00481741 1/1   CoA N-acyltransferases (Nat)            
  30::164  9.3e-11 24.0% 0052347 00523471 1/1   CoA N-acyltransferases (Nat)            
  28::161  1.1e-10 26.5% 0049884 00498841 1/1   CoA N-acyltransferases (Nat)            
  27::161  1.4e-10 23.3% 0049311 00493111 1/1   CoA N-acyltransferases (Nat)            
  27::163  1.7e-10 24.8% 0052874 00528741 1/1   CoA N-acyltransferases (Nat)            
  41::161    2e-10 27.9% 0043712 00437121 1/1   CoA N-acyltransferases (Nat)            
  28::161  2.8e-10 28.1% 0053292 00532921 1/1   CoA N-acyltransferases (Nat)            
  58::161  2.8e-10 30.7% 0046988 00469881 1/1   CoA N-acyltransferases (Nat)            
  29::161    4e-10 24.2% 0052522 00525221 1/1   CoA N-acyltransferases (Nat)            
  30::162  4.4e-10 25.8% 0051492 00514921 1/1   CoA N-acyltransferases (Nat)            
  29::160  8.5e-10 25.9% 0051232 00512321 1/1   CoA N-acyltransferases (Nat)            
  42::162    1e-09 26.4% 0052754 00527541 1/1   CoA N-acyltransferases (Nat)            
  27::161  1.6e-09 23.4% 0053076 00530761 1/1   CoA N-acyltransferases (Nat)            
  30::162  1.7e-09 25.4% 0045896 00458961 1/1   CoA N-acyltransferases (Nat)            
  66::161  1.8e-09 32.6% 0043128 00431281 1/1   CoA N-acyltransferases (Nat)            
  30::163  2.7e-09 25.0% 0051375 00513751 1/1   CoA N-acyltransferases (Nat)            
  49::161  2.7e-09 28.2% 0052701 00527011 1/1   CoA N-acyltransferases (Nat)            
  40::163  3.7e-09 24.8% 0051421 00514211 1/1   CoA N-acyltransferases (Nat)            
  42::164  5.5e-09 25.4% 0048433 00484331 1/1   CoA N-acyltransferases (Nat)            
  30::158  6.5e-09 22.0% 0045986 00459861 1/1   CoA N-acyltransferases (Nat)            
  30::161  7.8e-09 25.0% 0052664 00526641 1/1   CoA N-acyltransferases (Nat)            
  20::161  2.4e-08 21.6% 0052652 00526521 1/1   CoA N-acyltransferases (Nat)            
  31::144  2.8e-08 22.7% 0051777 00517771 1/1   CoA N-acyltransferases (Nat)            
  44::161  2.4e-06 24.8% 0049338 00493381 1/1   CoA N-acyltransferases (Nat)            
  35::161  2.7e-06 23.4% 0049219 00492191 1/1   CoA N-acyltransferases (Nat)            
  84::161  0.00088 34.6% 0051326 00513261 1/1   CoA N-acyltransferases (Nat)            
   1::162


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MESKENSKKSSEAKNKLEKIYSTSLPDGYRFTDFRIGDENNWAYIQYSAGVFKDYQLAIRRIFKEENSLK
00509401   1/1  ----------------------------mmdmsditirpatpeDleallallrea.fpeeeplsledlra
00490321   1/1  -----------------------------mtirpatpeDleallallneafvellgelpplsleellell
00514931   1/1  --------------------------glmslmtmditirpatpeDleallellrevfpeelpplsleelr
00528291   1/1  -------------------------mmditirpatpedleallallaeafaeelallll...........
00528581   1/1  -------------------------mmnitirpatpeDleailellreafrdtyafllspevlealgfde
00520401   1/1  ----------------------------------IRatpedleallellreafpeeylllllelllell.
00461581   1/1  -----------------------pttmri.tirpatpeDleallallreafvelpldpplsledlrelle
00472801   1/1  ------------------------mterltirpatpeDlpallallreafveeellpdleplsleelral
00486741   1/1  -------------------------mmeiirpltpadldallellaaagpadglavvellvllellgpll
00514201   1/1  --------------------------------------Pedleallallrelfeaplseeeseelleell
00517511   1/1  ------------------------mtmditirpatpeDleallallneafaelylfllspesleallerl
00461771   1/1  ----------------------kmiemrltirpatpeDleallellreafaefypelpplsleelrella
00512521   1/1  -------------------------mmditirpatpedleallelllel..fpeeys..leelle.....
00527131   1/1  --------------------------erltirpatpeDleallellneafveeflplsleelrefled..
00501851   1/1  ---------------------------rltirpatpeDleallalladafaeelylgfpeplsleelral
00519151   1/1  ---------------------------ditirpatpeDleallellrelfletylfllepltleellell
00488761   1/1  ----------------------------Miiirpatpedleailallrevf.peelplsleelrdlld..
00490311   1/1  --------------------------erltirpatpeDleallallneafeallgllppptleellerll
00512481   1/1  ----------------------------itirpatpeDleallallrea..flseeelrall........
00513771   1/1  -------------------MpptleterltlRpatpeDleallallaeapevlrylpplseeellerlre
00513031   1/1  -----------------------------mltirpatpeDleallallreafavlgaelpppsleeller
00480841   1/1  ------------------plpmmllmmditirpatpedldallallaaaf.pepfseafaeelldg....
00514371   1/1  --------------------------------Meirirpadledllallreafveefallppplsledlr
00496411   1/1  ---------------------------rltiRpatpeDleallalladafveeyalllpappldaellae
00507331   1/1  -------------------------tmrltirpatpeDleallallreafaellallglpplseeeseef
00498041   1/1  ----------------------------------------------------------------------
00502231   1/1  --------------------------m.itirpa.peDlpallallreafvellallllaplseelsler
00518301   1/1  ---------------------------mitirpatpedleallellreafleelplseeelrerla....
00527041   1/1  -------------------------pmditirpatpeDlpallallraafretyalllsaeqlealldea
00481741   1/1  ----------------------------yltirpatpeDleallallreafveppesledleelladppa
00523471   1/1  -----------------------------ltiRpatpeDlpallalladafpevyafllgtppldalaee
00498841   1/1  ---------------------------rltirpatpeDleallallndafvelylglllllafelaplsl
00493111   1/1  --------------------------mrltirpatpeDleallallaeafpelgeplsleelrellad..
00528741   1/1  --------------------------erltirpatpeDleallallndafveeylpalpeplsleelray
00437121   1/1  ----------------------------------------dwsqgllisslnlrlievikelaaskglkv
00532921   1/1  ---------------------------rltirpatpeDleallallndafveeyaglppplsleelrell
00469881   1/1  ---------------------------------------------------------mtiRpatpeDlpe
00525221   1/1  ----------------------------ltIrpatpeDleallellrelfaelglllpepeslelllell
00514921   1/1  -----------------------------HltirpatpeDleallallndafveeylllppplteeesle
00512321   1/1  ----------------------------itirpatpedleallelllevfpe.pyseelledlld.....
00527541   1/1  -----------------------------------------plptleterltlRpatpeDleallallnd
00530761   1/1  --------------------------mdltirpatpeDlpailallaeafaeelalllpeeplsleelaa
00458961   1/1  -----------------------------MtirpatpeDpllleallallrea..fpeelp....eesee
00431281   1/1  -----------------------------------------------------------------ellel
00513751   1/1  -----------------------------dltirpatpeDleallalladafveeylllfppplsleelr
00527011   1/1  ------------------------------------------------ltlrpltpedaeallallndaf
00514211   1/1  ---------------------------------------tiRpatpeDleallallndafveeyllpfpp
00484331   1/1  -----------------------------------------gmpptleterltlRpatpeDaeallallr
00459861   1/1  -----------------------------gtirpatlspeDleallallneafveefgllppldeeesle
00526641   1/1  -----------------------------ltirpatpeDleallallaeafaelylglppplsleellal
00526521   1/1  -------------------mlpmptleterliLrpltleDaeallell.sdpevlrylplrvppplslee
00517771   1/1  ------------------------------IRpatpeDleailelilelfeeealllpellalpldeeel
00493381   1/1  -------------------------------------------pptleterliLrpltleDaeallelln
00492191   1/1  ----------------------------------tmmmleiflvrlaltpeeleealrlRyevFveelgw
00513261   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           GNFKNRCVFLENENGERIGTIMIVPSLSEEEGVQEIKYLALLPKYQEQGLGKLLISKAYKMVDDVEGATR
00509401   1/1  lled....pgalflvaed.dgelvGfarlrpdddlp.dvaeigrlaVdpeyrgkGiGraLleallelare
00490321   1/1  lddpgalflvaedd.gelvGfarlrpl..pggdvaeigrlavdpeyrgkGiGraLlealleeare.lglk
00514931   1/1  ellad.....pgalflvaeddgelvGfarlrplpdg..gvaeigrlaVdpeyrgkGiGraLleallelar
00528291   1/1  ...pgalllvaeddgeivGfalllpl....ggvayieslaVdpeyrgqGiGraLleaaeeearer.glkr
00528581   1/1  glplseaeslerlrelledpgglflvaedd.gkivGfialspdgvlllglllllsllpggkvaeigrlaV
00520401   1/1  ....pgalflvaeddgelvGfarlrpldsllllgggvaeigrlavdpeyrgkGiGraLleallelarel.
00461581   1/1  dp.......galllvaed.dgelvGfarlrpldsllllllllllllpggdvaeigrlavdpeyrgkGiGr
00472801   1/1  leallalllldpgalflvaedeedgelvGfaglrplpdpvlglggvaeigdlavdpeyrgkGiGraLlea
00486741   1/1  drgtlfvalddgelvGfialipygepfafigllivhpdyrgrGigralleaalerlpgrplvllpeanpa
00514201   1/1  edg...lflvaedd.gelvGfaglrpdd...ggvaeigrlavdpeyrgkGiGraLlealleyare.lglr
00517511   1/1  l.........pgalflvaeddgelvGfallspidslpgggtaeieglaVdpeyrgkGiGsaLleallela
00461771   1/1  dp..galflvaeddgelvGfarlrpdgde..rvaeigrlaVdpeyrgkGiGraLleallelarer.glkr
00512521   1/1  ..lpgalllvaeddgeivGfallrplg....dvaeierlaVdpeyrgkGiGsaLlealeelaker.gcrr
00527131   1/1  ......pgalllvaeddgelvGfaglslidp...gtaeigrlavdpeyrgkGiGkallealleyakerlg
00501851   1/1  leel.....lpgglflvaededgelvGfaglrpiddgpagggvaei.glavdpeyrgkGigtallealle
00519151   1/1  ee.....llpgalvlvaedleelldkedgeivGfallrldystpggkvayiedlyVlpeyrgkGiGkaLl
00488761   1/1  ....pgalllvaeddgelvGfarllp....ggdvaeigrlaVdpeyrgkGiGraLleallelarel.glk
00490311   1/1  e......adpgglllvaedkedgelvGfaglrpidslllgggvaeigylavdpeyrgkGiGraLlealle
00512481   1/1  ...pgglllvaeddgeivGfaallpld...pdvaeigrlaVapeyrgkGiGkaLleallelarel.glkr
00513771   1/1  llad....pgslflvaed.dgelvGfaglrpid.agegvaeigylavdpeyrGkGiGtallealleyafr
00513031   1/1  llddpgllflvae.ddgelvGfarlrp..dgdepvaeigrlaVdpeyrgkGiGraLlealleyareelgl
00480841   1/1  .....lvlvaed.dgrvvGfaallplrlliggrggrvgyiegvaVhpdyRGqGlGsaLldaaeeeare..
00514371   1/1  elledpgalflvaeddgelvGfaalrpld...ggvaeigrlavdpeyrgkGiGraLleallelarer.gl
00496411   1/1  rslerlrellad.ggalllvaed.dgelvGfaglrpldsllalpgggvaeigylavdpeyrgkGiGraLl
00507331   1/1  lrellad.......pgalllvaed.dgelvGfaglrpdddetgggrpvaeigylavdpeyrgkGiGraLl
00498041   1/1  -----lflvaedd.geivGfaglrpddsglagdllgllllglllllglllllllllpgggvaeigrlaVd
00502231   1/1  lrellad....pgglllvaedddGelvGfaglrpdddlplgggvaeigdlavdpeyrgkGiGraLleall
00518301   1/1  ......dgalllvaeddgelvGfarlvpd...gddvayigdlaVlpeyrgqGiGkaLleaalelakel.g
00527041   1/1  eslerlrellpgalvlvaeddgeivGfaal.......ggvaeierlyVhpdyrgrGiGraLlealeelar
00481741   1/1  l.......llvaed.dgelvGfaglrpldde.grvaeigylavdpeyrgkGiGraLlealleyare.lgl
00523471   1/1  eslerleelladgdale.....lflvaeddggelvGfaglrpiddgpggklvaeigglavdpeyrGkGiG
00498841   1/1  eellerlrelladggalllvaed.dgeplvGfaglrpidsegggvaeigglavdpeyrgkGiGraLleal
00493111   1/1  ...pgalllvaeddgelvGfaglslldslllgldgggvaeieglyVlpeyrgrGiGraLlaallewarer
00528741   1/1  ler.....ladpgslflvaedd.gelvGfaglrpiddeplggvaei.glavdpeyrgkGiGtallealle
00437121   1/1  ellratlllvlprelafllelpevpdgfrlrpldvddaalvnelwphggpeslefleellrdp.pslvlv
00532921   1/1  ae.....adpgalflvaedakedgepgepelvGfaglrpidspggggvaeigylavdpeyrgkGiGraLl
00469881   1/1  lldallallrdafaellalllpeplseeeleellerlledladpgalflvaed.dgelvGfaglrpddde
00525221   1/1  ad........pgalllvavdeedgelvGfaalslldstlagrdvaeiedlyVapeyrgqGiGkaLleall
00514921   1/1  rlrelladp........gslllvaeddgelvGfaglrpldslllpgggvaeigglavdpeyrgkGiGraL
00512321   1/1  ...psalvlvaeddgelvGfarlipdg...gdvaeigdlaVlpeyrgkGiGsaLlealleyakel.glkr
00527541   1/1  aevellggplspedleeflerllerlad........pgalllvaedkedgelvGfvglrp.id.eggvae
00530761   1/1  ll........apgalllvaed.dgelvGfalllplds..gdvaelgdlaVapearGrGiGraLlealeel
00458961   1/1  llrelladpelflvaed.dgelvGfarlrpl..pggdvaeigrlaVdpeyRGkGiGraLlealleearer
00431281   1/1  ldlpgslffvaeddgeivGfarlrpldd...dvaeieslaVdpeyrgqGiGkkLlealleyarel.glkr
00513751   1/1  alleella.....pgslllvaeddgelvGfaglrpiddepgggvaeigglavdpeyrgkGigtalleall
00527011   1/1  valyllgpppplsleelrerleedl.......gggllfvaeddgelvGfvgl..rpdpdggvaeigylav
00514211   1/1  plsleeleerlrellad........gdg.llvaeddtgelvGfaglrpiddgplglgvaei.glavdpey
00484331   1/1  eadpevarllpflgpplsleelraflerllaaea.......ldpgglflvaeddgelvGfaglrpidde.
00459861   1/1  llrellad.....pgalllvaeddgelvGfaglrplddlplgldvaeigdlavdpeyrgkGiGraLleal
00526641   1/1  laell......pgglflvaedd.gelvGfaglrpldslllgggvaeigglavdpeyrgkGiGraLleall
00526521   1/1  areflerllalyasggalvfaiedkedgeliGfiglrridpen.gtaeig.ywlapeyqgkGyatealka
00517771   1/1  lelleellenpnslllvaed.dgeivGfillylefs..gdvaeiellyVdpeyRgqGigtaLlealeewa
00493381   1/1  dpealvarylpwlpsplsleearaflerllalyadggalvfvied...dgelvGfiglrridpen.gtae
00492191   1/1  dlgvpdglelDefDalathllvadd.dgevvGtvRllpttgplmlgdlysellfdlllplgpdvaeigRl
00513261   1/1  -------------dgepvGyvelywvkedelgyyydaepgdrgihlligdpdyrgkGlgtallraliayl


                         +         -         -         -         -         *         -:210
query           INLEAYNDKSIVLFENLGFERS------------------------------------------------
00509401   1/1  rlglrrlvlev.npaairfYe-------------------------------------------------
00490321   1/1  rlvlev.neaairfYeklGFe-------------------------------------------------
00514931   1/1  el.glkrlvlevdne.airfY-------------------------------------------------
00528291   1/1  lylevdnpaairlYeklGFev-------------------------------------------------
00528581   1/1  dpeyrGkGiGsaLleaalera-------------------------------------------------
00520401   1/1  glkrlvlev.npaairfYekl-------------------------------------------------
00461581   1/1  aLleallelarerlglrrlvlev.----------------------------------------------
00472801   1/1  llelarel.glrrlvlev.ne-------------------------------------------------
00486741   1/1  llalleklgfrlarellrmql-------------------------------------------------
00514201   1/1  rlvlevladNeaairfYeklG-------------------------------------------------
00517511   1/1  re.lglkrlylevladNeaai-------------------------------------------------
00461771   1/1  lvlevdne.airfYeklGFev-------------------------------------------------
00512521   1/1  lllevlneaairfYeklGFee-------------------------------------------------
00527131   1/1  lkrlylevledNeaairlYek-------------------------------------------------
00501851   1/1  yare.lglrrlvlevdpdNeaair----------------------------------------------
00519151   1/1  ealeelaker.gckrlylevl-------------------------------------------------
00488761   1/1  rlvlev.neaairfYeklGFe-------------------------------------------------
00490311   1/1  yarel.glkrlvlevlpdNe--------------------------------------------------
00512481   1/1  lvlevladntaaialYeklGF-------------------------------------------------
00513771   1/1  elglrrlvlevdadNeaairlyek----------------------------------------------
00513031   1/1  rrlvlevdne.airfYeklGFee-----------------------------------------------
00480841   1/1  garrlvLev.naaarrfYerlGFv----------------------------------------------
00514371   1/1  rrlvlevlvlpdNeaairlye-------------------------------------------------
00496411   1/1  ealleyare.lglrrlvlevd-------------------------------------------------
00507331   1/1  ealleyarel.g.rrlvlevl-------------------------------------------------
00498041   1/1  peyrGkGiGraLlealleyar-------------------------------------------------
00502231   1/1  elarel.glrrlvlevlpdNa-------------------------------------------------
00518301   1/1  akriylev.neaaiafYeklG-------------------------------------------------
00527041   1/1  er.garrltlev.neaairfY-------------------------------------------------
00481741   1/1  rrlvlevlpdNeaairlyekl-------------------------------------------------
00523471   1/1  taLlealleyarer.glrrlvlev----------------------------------------------
00498841   1/1  leyare.lglkrivlevlpdN-------------------------------------------------
00493111   1/1  .GarrlvlevlpdNtaairlY-------------------------------------------------
00528741   1/1  yarel.glkrivlevdpdNeaai-----------------------------------------------
00437121   1/1  aed.dgelvGfaglspg....-------------------------------------------------
00532921   1/1  ealleyarel.glkrivlevl-------------------------------------------------
00469881   1/1  pggpvaeigylavdpeyrgkG-------------------------------------------------
00525221   1/1  elarer.gakrlrlevladNe-------------------------------------------------
00514921   1/1  lealleyarel.glrrlvlevl------------------------------------------------
00512321   1/1  iylevladnpaiklYeklGF--------------------------------------------------
00527541   1/1  ig.lavapeyrGkGigtellea------------------------------------------------
00530761   1/1  arerlgarrlrlevledNaaa-------------------------------------------------
00458961   1/1  .glkriylevledNeaadesli------------------------------------------------
00431281   1/1  ill...npaaikfyeklGFev-------------------------------------------------
00513751   1/1  eyare.lglrrlvlevdpdNeaa-----------------------------------------------
00527011   1/1  lpdyrgkGigtellralleya-------------------------------------------------
00514211   1/1  rgkGiGtaLlealleyare.lgl-----------------------------------------------
00484331   1/1  ggvaei.glavapeyrGkGiGtel----------------------------------------------
00459861   1/1  lelarel.glkrlvlevl----------------------------------------------------
00526641   1/1  eyarer.glrrlvlevlpdNe-------------------------------------------------
00526521   1/1  lldyafeelglhrieatvdpd-------------------------------------------------
00517771   1/1  kel.------------------------------------------------------------------
00493381   1/1  ig.ywvdpsyrGkGiatealk-------------------------------------------------
00492191   1/1  aVdpeyrgkgglpligrlLla-------------------------------------------------
00513261   1/1  flddpgarrivlepdadNtaa-------------------------------------------------