[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cper0:BAB80292.1


[Show Plain Result]

## Summary of Sequence Search
   1::248
  73::234  1.1e-32 30.8% 0040524 00405241 1/1   RpiA/CoA transferase-like               
  74::236    2e-28 29.2% 0040229 00402291 1/1   RpiA/CoA transferase-like               
  73::236  4.2e-27 26.2% 0040719 00407191 1/1   RpiA/CoA transferase-like               
  73::249  9.5e-25 24.8% 0044389 00443891 1/1   RpiA/CoA transferase-like               
   2::81   9.5e-14 41.2% 0043758 00437581 1/1   ed helix" DNA-binding domain            
   1::61   3.9e-08 45.9% 0039384 00393841 1/1   ed helix" DNA-binding domain            
   1::63   2.6e-06 33.3% 0045968 00459681 1/1   ed helix" DNA-binding domain            
  10::71   2.8e-05 29.5% 0044139 00441391 1/1   ed helix" DNA-binding domain            
   3::76     5e-05 33.8% 0037456 00374561 1/1   ed helix" DNA-binding domain            
   3::59   6.5e-05 35.1% 0045862 00458621 1/1   ed helix" DNA-binding domain            
  10::69   8.6e-05 33.9% 0043062 00430621 1/1   ed helix" DNA-binding domain            
   4::51   0.00011 37.5% 0035347 00353471 1/1   ed helix" DNA-binding domain            
   4::59   0.00012 37.5% 0048605 00486051 1/1   ed helix" DNA-binding domain            
   2::55   0.00017 33.3% 0040266 00402661 1/1   ed helix" DNA-binding domain            
  10::47   0.00017 50.0% 0045030 00450301 1/1   ed helix" DNA-binding domain            
   4::94   0.00018 23.9% 0049384 00493841 1/1   ed helix" DNA-binding domain            
   4::54   0.00036 33.3% 0052364 00523641 1/1   ed helix" DNA-binding domain            
   2::54   0.00082 40.4% 0047283 00472831 1/1   ed helix" DNA-binding domain            
   1::248


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLSEKRHEIILNLLKLKGFVSLTELLEATESSESTIRRDLSYLESINLLKRVHGGAKSLANVSKELSYNE
00405241   1/1  ----------------------------------------------------------------------
00402291   1/1  ----------------------------------------------------------------------
00407191   1/1  ----------------------------------------------------------------------
00443891   1/1  ----------------------------------------------------------------------
00437581   1/1  -elterqrlilellvelylkeggpvsvreLaellglgvSraTirrdLaeLeelGllervhggagriptlk
00393841   1/1  llmllderlllillllleggepvsveeLaeelgvsrstvrrdlalLeelglvirrrgggyr---------
00459681   1/1  lllderrlkillllledgrlsveeLaeelgvSrstvrrhlkrLeeaGliiesvpgkgyrllld-------
00441391   1/1  ---------ildlLa.dgpltvaeLaaalgldpsllsrlLralvalglveededgryaltplsklLlsds
00374561   1/1  --KeeRqalIlellkekgivtqeeLaellkeegfdvsqatisRdlkel...glvkvrsengeyvyalpee
00458621   1/1  --ledylklillllledgplsvseLaerlgvspptvsralkrLeedGlvererdggdrl-----------
00430621   1/1  ---------ildlLa.dgpltvaeLAerlglspsalsrlLrlLaslglveedgegrrvyrltpvsrlLl-
00353471   1/1  ---aeRqalIlellkeneiltqeelaelLkeeginvsqatisrdlkelglv-------------------
00486051   1/1  ---edylllilllllengpvsvselaerlgvspstvtrlvkrLeekglverepdggvlL-----------
00402661   1/1  -iflllraarllikllgellkrlglsptrlriLalLaesdgpltvselaeelgls---------------
00450301   1/1  ---------PeatikrlplylrilellleegvervsseeLaellgvs-----------------------
00493841   1/1  ---llrllleelaellkalgldptrlriLllLlenggltvseLaeelglsrstvsrrlkrLeeaGlvere
00523641   1/1  ---raaraliellaellkalgldptrlriLllLlengepltvseLaellglsks----------------
00472831   1/1  -ldeleleilllllengpl.siselaerlglskstvsrhlkkLeeagliervgl----------------


                         -         -         *         -         -         -         -:140
query           KSSKSIHEKRAIAKYAASLIEDGDCIFVDAGTTTYELIDYLEGKDILVVSNGLSHIDTLIQKNIKCYVIG
00405241   1/1  --llnleeKkaiAkaAaelvkdgdviglgtGsTvlllielLaervkegelkdltvvtnslqtalllle..
00402291   1/1  ---lqlelKkaiAkaAaelvedgmvvglgsGsTvlllieaLaellkkgltvvtnslatalllle......
00407191   1/1  --itllelKkaiAraAvelvkdgmviglgtGsTvlllieaLgelllkgltvvtnslatalllae......
00443891   1/1  --kllleaKkaiAraAaelvedgmvvglgtGstvlllaeaLaellsengllgltvvtnslevalllielg
00437581   1/1  gyrlyvdkllk-----------------------------------------------------------
00393841   1/1  ----------------------------------------------------------------------
00459681   1/1  ----------------------------------------------------------------------
00441391   1/1  p---------------------------------------------------------------------
00374561   1/1  lgvpil----------------------------------------------------------------
00458621   1/1  ----------------------------------------------------------------------
00430621   1/1  ----------------------------------------------------------------------
00353471   1/1  ----------------------------------------------------------------------
00486051   1/1  ----------------------------------------------------------------------
00402661   1/1  ----------------------------------------------------------------------
00450301   1/1  ----------------------------------------------------------------------
00493841   1/1  rapldgrkvgysltekg...elle----------------------------------------------
00523641   1/1  ----------------------------------------------------------------------
00472831   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           GNIKISTKAITGCDALMCLSKFRFDKCFIGANGVHHTYGLTTPDTEEAILKECAINNSRKAYVLADDSKF
00405241   1/1  .................lgillldllevlrvdlafdGadgvdpdlglikggggallrekivasaakefiv
00402291   1/1  .............lgiplldllevlrldlafdGadevdpdlglikggggallrekivaaaakefivlads
00407191   1/1  .............lgiplldllevlrldiafdGadevdpdlglikggggallrekivasaakkfivlvDs
00443891   1/1  ipvv....................llrglhvdlailGadevdpdlglikggggallvekilaaaAkrviv
00437581   1/1  ----------------------------------------------------------------------
00393841   1/1  ----------------------------------------------------------------------
00459681   1/1  ----------------------------------------------------------------------
00441391   1/1  ----------------------------------------------------------------------
00374561   1/1  ----------------------------------------------------------------------
00458621   1/1  ----------------------------------------------------------------------
00430621   1/1  ----------------------------------------------------------------------
00353471   1/1  ----------------------------------------------------------------------
00486051   1/1  ----------------------------------------------------------------------
00402661   1/1  ----------------------------------------------------------------------
00450301   1/1  ----------------------------------------------------------------------
00493841   1/1  ----------------------------------------------------------------------
00523641   1/1  ----------------------------------------------------------------------
00472831   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           GEISTIKFSDINKCVIITNEKPKDNTYDKKTDIKVVDI--------------------------------
00405241   1/1  ladssKlvkvlglfplplevipll----------------------------------------------
00402291   1/1  sKlvkvlgvkfplpvevvplatdlvl--------------------------------------------
00407191   1/1  sKlvkvlgafplpveviplaitdvlr--------------------------------------------
00443891   1/1  ladhsKlvkvlglfllplevidl............liTd-------------------------------
00437581   1/1  ----------------------------------------------------------------------
00393841   1/1  ----------------------------------------------------------------------
00459681   1/1  ----------------------------------------------------------------------
00441391   1/1  ----------------------------------------------------------------------
00374561   1/1  ----------------------------------------------------------------------
00458621   1/1  ----------------------------------------------------------------------
00430621   1/1  ----------------------------------------------------------------------
00353471   1/1  ----------------------------------------------------------------------
00486051   1/1  ----------------------------------------------------------------------
00402661   1/1  ----------------------------------------------------------------------
00450301   1/1  ----------------------------------------------------------------------
00493841   1/1  ----------------------------------------------------------------------
00523641   1/1  ----------------------------------------------------------------------
00472831   1/1  ----------------------------------------------------------------------