[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cper0:BAB80503.1


[Show Plain Result]

## Summary of Sequence Search
   1::193
   2::176  4.5e-29 26.7% 0036249 00362491 1/1   phosphatase/Vanadium-dependent halopero 
  12::176  9.3e-23 29.1% 0042804 00428041 1/1   phosphatase/Vanadium-dependent halopero 
  70::158  9.6e-17 36.0% 0044900 00449001 1/1   phosphatase/Vanadium-dependent halopero 
  78::158  2.1e-07 32.1% 0042785 00427851 1/1   phosphatase/Vanadium-dependent halopero 
 102::158  0.00052 38.2% 0044476 00444761 1/1   phosphatase/Vanadium-dependent halopero 
   1::193


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNFWNDIFNSINGLAGKNHLLDSIMLFSSKRLPYILFATVIVVYLIGIISKNKKARGIAVDTIVFTGINL
00362491   1/1  -aldlalflainal..rnplldrlavfltalgdgavllllaaalll.llllrrrlrlaalllllalalal
00428041   1/1  -----------tvagiflsydgpnpiprldealavrlafialelkvdlvlidlnnneedfianftkglnh
00449001   1/1  ---------------------------------------------------------------------g
00427851   1/1  ----------------------------------------------------------------------
00444761   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           ILAVIVGHFFYAPRPFVNDPNAKLLYPHKPDSSFPSGHSVGSMSIALGLNRYNKALGTICVILSILMGIS
00362491   1/1  lltlllKllfgrpRPfllllegictvdpllvlaggySFPSGHaaaafalalalalllprrgilllllall
00428041   1/1  dlfvainaaaaelllearlndglddiepvppgvaplgpvwglvnpfaglaidlvlpsalaltppppPald
00449001   1/1  laawllKllygrpRPfvairdgnlngeadptwltlgsfllnvapllptpphpSfPSGHatfsfavagvLa
00427851   1/1  -------flvhgrlRPetaiglvgllvtgglsldillvefdpsvlensglldrvailndtdgnegtvvdp
00444761   1/1  -------------------------------psYPSGHAtfagAlatvLkalfg..ggavtpilfevdsd


                         +         -         -         -         -         *         -:210
query           RVYVGHHYPQHVVASFLIVIILNVLYMKFLSKSVQKLYFSIEKHIPILNKLVK-----------------
00362491   1/1  vglSRvylgvHypsDVlaGallGaavalllllllar----------------------------------
00428041   1/1  slelaadlaevywlallrdtprtlaqtddaifaaaa----------------------------------
00449001   1/1  llfprrlltfsdtsgdli----------------------------------------------------
00427851   1/1  gwtpLlpqaategtPphp----------------------------------------------------
00444761   1/1  glelilstlpdvlrvagl----------------------------------------------------