[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cper0:BAB80582.1


[Show Plain Result]

## Summary of Sequence Search
   1::147
   1::147  4.8e-23 30.3% 0051915 00519151 1/1   CoA N-acyltransferases (Nat)            
   1::145  4.3e-21 29.0% 0048876 00488761 1/1   CoA N-acyltransferases (Nat)            
   1::146    1e-19 29.5% 0051252 00512521 1/1   CoA N-acyltransferases (Nat)            
   1::146  1.1e-19 26.2% 0046988 00469881 1/1   CoA N-acyltransferases (Nat)            
   1::146    3e-18 27.8% 0052829 00528291 1/1   CoA N-acyltransferases (Nat)            
   1::145    5e-18 25.9% 0050940 00509401 1/1   CoA N-acyltransferases (Nat)            
   1::144  6.8e-18 25.2% 0050223 00502231 1/1   CoA N-acyltransferases (Nat)            
   1::145  6.8e-18 27.9% 0052858 00528581 1/1   CoA N-acyltransferases (Nat)            
   1::146    8e-18 27.1% 0046158 00461581 1/1   CoA N-acyltransferases (Nat)            
   1::146  4.7e-17 27.0% 0051437 00514371 1/1   CoA N-acyltransferases (Nat)            
   3::146  6.1e-17 26.9% 0051493 00514931 1/1   CoA N-acyltransferases (Nat)            
   1::144  8.5e-17 23.9% 0049804 00498041 1/1   CoA N-acyltransferases (Nat)            
   1::145  8.9e-17 24.5% 0049311 00493111 1/1   CoA N-acyltransferases (Nat)            
   3::144  9.9e-17 23.2% 0051492 00514921 1/1   CoA N-acyltransferases (Nat)            
   1::139  1.3e-16 27.7% 0052713 00527131 1/1   CoA N-acyltransferases (Nat)            
   1::146  1.4e-16 26.7% 0052704 00527041 1/1   CoA N-acyltransferases (Nat)            
   4::144  1.9e-16 25.2% 0048674 00486741 1/1   CoA N-acyltransferases (Nat)            
   1::146  2.1e-16 25.4% 0049032 00490321 1/1   CoA N-acyltransferases (Nat)            
   1::146  2.9e-16 25.5% 0051751 00517511 1/1   CoA N-acyltransferases (Nat)            
   3::146  2.9e-16 25.2% 0051375 00513751 1/1   CoA N-acyltransferases (Nat)            
   1::145    3e-16 27.3% 0051830 00518301 1/1   CoA N-acyltransferases (Nat)            
   3::144  3.6e-16 25.0% 0053292 00532921 1/1   CoA N-acyltransferases (Nat)            
   1::144  4.3e-16 26.8% 0047280 00472801 1/1   CoA N-acyltransferases (Nat)            
   1::145  5.1e-16 21.5% 0051377 00513771 1/1   CoA N-acyltransferases (Nat)            
   3::146  5.1e-16 29.1% 0051248 00512481 1/1   CoA N-acyltransferases (Nat)            
   3::147  5.9e-16 23.8% 0051421 00514211 1/1   CoA N-acyltransferases (Nat)            
   1::141    1e-15 26.2% 0045896 00458961 1/1   CoA N-acyltransferases (Nat)            
   1::148  2.8e-15 23.4% 0053076 00530761 1/1   CoA N-acyltransferases (Nat)            
   3::145  2.8e-15 24.8% 0049031 00490311 1/1   CoA N-acyltransferases (Nat)            
   3::148  3.5e-15 24.5% 0050185 00501851 1/1   CoA N-acyltransferases (Nat)            
   3::145  4.9e-15 23.4% 0052664 00526641 1/1   CoA N-acyltransferases (Nat)            
   3::139  5.1e-15 24.8% 0049884 00498841 1/1   CoA N-acyltransferases (Nat)            
   3::143  5.1e-15 24.4% 0051303 00513031 1/1   CoA N-acyltransferases (Nat)            
   9::147  5.2e-15 27.9% 0051420 00514201 1/1   CoA N-acyltransferases (Nat)            
   2::132  5.8e-15 24.4% 0045986 00459861 1/1   CoA N-acyltransferases (Nat)            
   3::149  6.5e-15 24.5% 0049641 00496411 1/1   CoA N-acyltransferases (Nat)            
   2::142  7.8e-15 25.6% 0051232 00512321 1/1   CoA N-acyltransferases (Nat)            
   7::142  8.1e-15 25.4% 0052040 00520401 1/1   CoA N-acyltransferases (Nat)            
   3::147  3.4e-14 26.0% 0048084 00480841 1/1   CoA N-acyltransferases (Nat)            
   4::147  3.6e-14 27.9% 0046177 00461771 1/1   CoA N-acyltransferases (Nat)            
   3::139  4.2e-14 25.9% 0052874 00528741 1/1   CoA N-acyltransferases (Nat)            
   3::145  1.4e-13 25.2% 0052522 00525221 1/1   CoA N-acyltransferases (Nat)            
   3::145  1.5e-13 21.7% 0052347 00523471 1/1   CoA N-acyltransferases (Nat)            
   3::147  2.2e-13 22.9% 0050733 00507331 1/1   CoA N-acyltransferases (Nat)            
   3::146  3.3e-13 23.7% 0048174 00481741 1/1   CoA N-acyltransferases (Nat)            
   3::149  5.3e-13 20.0% 0048433 00484331 1/1   CoA N-acyltransferases (Nat)            
   1::145  2.4e-12 25.4% 0043712 00437121 1/1   CoA N-acyltransferases (Nat)            
   1::139  2.9e-12 20.7% 0052754 00527541 1/1   CoA N-acyltransferases (Nat)            
   4::117  8.5e-12 29.5% 0051777 00517771 1/1   CoA N-acyltransferases (Nat)            
   3::147  2.8e-11 22.7% 0052701 00527011 1/1   CoA N-acyltransferases (Nat)            
  40::148  2.3e-10 28.4% 0043128 00431281 1/1   CoA N-acyltransferases (Nat)            
   4::135  5.6e-07 19.2% 0052652 00526521 1/1   CoA N-acyltransferases (Nat)            
   3::135    1e-06 22.9% 0049338 00493381 1/1   CoA N-acyltransferases (Nat)            
   1::138  0.00018 21.7% 0051326 00513261 1/1   CoA N-acyltransferases (Nat)            
   1::146   0.0003 24.1% 0049219 00492191 1/1   CoA N-acyltransferases (Nat)            
   1::147


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSNIYEFKKEDLNECAELFVKTFSKEPWNEPWDFENAKKRLNDVVLTPGFRGAVLRNDEKIEGVILGNLE
00519151   1/1  ditirpatpeDleallellrelfletylfllepltleellellee..llpgalvlvaedleelldkedge
00488761   1/1  Miiirpatpedleailallrevf...peelplsleelrdlld.....pgalllvaeddgelvGfarllp.
00512521   1/1  mmditirpatpedleallelllelfpeeys.leelle...........lpgalllvaeddgeivGfallr
00469881   1/1  m.tiRpatpeDlpelldallallrdafaellalllpeplseeeleellerlledladpgalflvaeddge
00528291   1/1  mmditirpatpedleallallaeafaeelallll...............pgalllvaeddgeivGfalll
00509401   1/1  mmdmsditirpatpeDleallallrea...fpeeeplsledlralled....pgalflvaeddgelvGfa
00502231   1/1  mitirpa.peDlpallallreafvellallllaplseelslerlrellad....pgglllvaedddGelv
00528581   1/1  mmnitirpatpeDleailellreafrdtyafllspevlealgfdeglplseaeslerlrelled....pg
00461581   1/1  pttmritirpatpeDleallallreafvelpldpplsledlrelledp....galllvaeddgelvGfar
00514371   1/1  M.ei.rirpadledllallreafveefallppplsledlrelled....pgalflvaeddgelvGfaalr
00514931   1/1  --glmslmtmditirpatpeDleallellrevfpeel..pplsleelrellad....pgalflvaeddge
00498041   1/1  me.iRpatpeDlpallallneafpevaaflgsppl.splseeelrellaadladgplglflvaeddgeiv
00493111   1/1  mrltirpatpeDleallallaeaf..pelgeplsleelrellad....pgalllvaeddgelvGfaglsl
00514921   1/1  --HltirpatpeDleallallndafveeylllppplteeeslerlrelladpgslllvaeddgelvGfag
00527131   1/1  erltirpatpeDleallellneafveef..lplsleelrefled....pgalllvaeddgelvGfaglsl
00527041   1/1  pmditirpatpeDlpallallraafretyalllsaeqlealldeaeslerlrell......pgalvlvae
00486741   1/1  ---mmeiirpltpadldallellaaagpadglavvellvllellgplldrgtlfvalddgelvGfialip
00490321   1/1  m.tirpatpeDleallallneafvellgelpplsleellell...lddpgalflvaeddgelvGfarlrp
00517511   1/1  mtmditirpatpeDleallallneafaelylfllspesleallerll.....pgalflvaeddgelvGfa
00513751   1/1  --dltirpatpeDleallalladafveeylllfppplsleelralleella.pgslllvaeddgelvGfa
00518301   1/1  mitirpatpedleallellreafleel...plseeelrerla.....dgalllvaeddgelvGfarlvpd
00532921   1/1  --rltirpatpeDleallallndafveeyaglppplsleelrellae..adpgalflvaedakedgepge
00472801   1/1  mterltirpatpeDlpallallreafveeellpdleplsleelralleallalllldpgalflvaedeed
00513771   1/1  MpptleterltlRpatpeDleallallaeapevlrylpplseeellerlrelladpgslflvaeddgelv
00512481   1/1  --itirpatpeDleallallreaf........lseeelrall......pgglllvaeddgeivGfaallp
00514211   1/1  --tiRpatpeDleallallndafveeyllpfppplsleeleerlrelladgdg.llvaeddtgelvGfag
00458961   1/1  M.tirpatpeDpllleallallreafpeelp......eeseellrelladpel.flvaeddgelvGfarl
00530761   1/1  mdltirpatpeDlpailallaeafaeelalllpeeplsleelaall.apgalllvaeddgelvGfalllp
00490311   1/1  --erltirpatpeDleallallneafeallgllppptleellerlle..adpgglllvaedkedgelvGf
00501851   1/1  --rltirpatpeDleallalladafaeelylgfpeplsleelralleel..lpgglflvaededgelvGf
00526641   1/1  --ltirpatpeDleallallaeafaelylglppplsleellallaell..pgglflvaeddgelvGfagl
00498841   1/1  --rltirpatpeDleallallndafvelylglllllafelaplsleellerlrelladggalllvaeddg
00513031   1/1  --mltirpatpeDleallallreafavlgaelppp..sleellerllddpgllflvaeddgelvGfarlr
00514201   1/1  --------Pedleallallrelf.eaplseeeseelleelledg......lflvaeddgelvGfaglrpd
00459861   1/1  -gtirpatlspeDleallallneafveefgllppldeeeslellrellad....pgalllvaeddgelvG
00496411   1/1  --rltiRpatpeDleallalladafveeyalllpappldaellaerslerlrellad....ggalllvae
00512321   1/1  -itirpatpedleallelllevfpe.....pyseelledlld.....psalvlvaeddgelvGfarlipd
00520401   1/1  ------IRatpedleallellreafpeeylllllelllell........pgalflvaeddgelvGfarlr
00480841   1/1  --plpmmllmmditirpatpedldallallaaaf.pepfseafaeel..........ldg.lvlvaeddg
00461771   1/1  ---kmiemrltirpatpeDleallellreafaefypelpplsleelrelladp....galflvaeddgel
00528741   1/1  --erltirpatpeDleallallndafveeylpalpeplsleelrayler.ladpgslflvaeddgelvGf
00525221   1/1  --ltIrpatpeDleallellrelfaelglllpepeslelllellad....pgalllvavdeedgelvGfa
00523471   1/1  --ltiRpatpeDlpallalladafpevyafllgtppldalaeeeslerleelladgdalelflvaeddgg
00507331   1/1  --tmrltirpatpeDleallallreafaellallglpplseeeseeflrelladpgalllvaeddgelvG
00481741   1/1  --yltirpatpeDleallallreafve....ppesledleelladppal....llvaeddgelvGfaglr
00484331   1/1  --gmpptleterltlRpatpeDaeallallreadpevarllpflgpplsleelraflerllaaealdpgg
00437121   1/1  MltiRpatpeDlpallellvdafpetyatvltldnlrrwlfkisvlkiliddlisillpgllllllsgdf
00527541   1/1  plptleterltlRpatpeDleallallndaeve.llggplspedleeflerllerladpgalllvaedke
00517771   1/1  ---IRpatpeDleailelilelfeeealllpellalpldeeellelleellenpnslllvaeddgeivGf
00527011   1/1  --ltlrpltpedaeallallndafvalyllgpppplsleelrerleedl..gggllfvaeddgelvGfvg
00431281   1/1  ---------------------------------------ellelldlpgslffvaeddgeivGfarl...
00526521   1/1  ---mlpmptleterliLrpltleDaeallellsdpevlrylplrvppplsleeareflerllalyasgga
00493381   1/1  --pptleterliLrpltleDaeallellndpealvarylpwlpsplsleearaflerllalyadggalvf
00513261   1/1  ltltvlvlhplrppkpapgsvvysrpipllggrlslRpltleDlelllewlndphvaawwglplsleevr
00492191   1/1  tmmmleiflvrlaltpeeleealrlRyevFveel...gwdlgvpdglelDefDalathllvadddgevvG


                         -         -         *         -         -         -         -:140
query           QWYDGEHFCVKEFFVDSSSQGKGTGKKLLNALEDILMEKEVGVIHFWTMKGSTAEAFYNKRGYEIPKELI
00519151   1/1  ivGfallrldystpggkvayiedlyVlpeyrgkGiGkaLlealeelakergckrlylevledNepairfY
00488761   1/1  ...ggdvaeigrlaVdpeyrgkGiGraLleallelarelglkrlvlev..neaairfYeklGFevvgelp
00512521   1/1  plg....dvaeierlaVdpeyrgkGiGsaLlealeelakergcrrlllevl.neaairfYeklGFeevge
00469881   1/1  lvGfaglrpdddepggpvaeigylavdpeyrgkGiGraLlealleyarelglkrivlevladNeairlYe
00528291   1/1  pl....ggvayieslaVdpeyrgqGiGraLleaaeeearerglkrlylevd.npaairlYeklGFevvge
00509401   1/1  rlrpdddlp.dvaeigrlaVdpeyrgkGiGraLleallelarerlglrrlvlev..npaairfYeklGFe
00502231   1/1  GfaglrpdddlplgggvaeigdlavdpeyrgkGiGraLleallelarelglrrlvlevlpdNaairlYek
00528581   1/1  glflvaeddgkivGfialspdgvlllglllllsllpggkvaeigrlaVdpeyrGkGiGsaLleaalerak
00461581   1/1  lrpldsllllllllllllpggdvaeigrlavdpeyrgkGiGraLleallelarerlglrrlvlev..nea
00514371   1/1  pld...ggvaeigrlavdpeyrgkGiGraLleallelarerglrrlvlevlvlpdNeaairlyeklGFev
00514931   1/1  lvGfarlrplpdg..gvaeigrlaVdpeyrgkGiGraLleallelarelglkrlvlev..dneairfYek
00498041   1/1  GfaglrpddsglagdllgllllglllllglllllllllpgggvaeigrlaVdpeyrGkGiGraLlealle
00493111   1/1  ldslllgldgggvaeieglyVlpeyrgrGiGraLlaallewarerGarrlvlevlpdNtaairlYeklGF
00514921   1/1  lrpldslllpgggvaeigglavdpeyrgkGiGraLlealleyarelglrrlvlevlpdNeaairlyeklG
00527131   1/1  idp...gtaeigrlavdpeyrgkGiGkallealleyakerlglkrlylevledNeaairlYeklGFvev-
00527041   1/1  ddgeivGfaal.......ggvaeierlyVhpdyrgrGiGraLlealeelarergarrltlev..neaair
00486741   1/1  ygepfafigllivhpdyrgrGigralleaalerlpgrplvllpeanpallalleklgfrlarellrmqld
00490321   1/1  l..pggdvaeigrlavdpeyrgkGiGraLlealleearelglkrlvlev..neaairfYeklGFeevgel
00517511   1/1  llspidslpgggtaeieglaVdpeyrgkGiGsaLleallelarelglkrlylevladNeaairfYeklGF
00513751   1/1  glrpiddepgggvaeigglavdpeyrgkGigtallealleyarelglrrlvlevdpdNeaairlyeklGF
00518301   1/1  ...gddvayigdlaVlpeyrgqGiGkaLleaalelakelgakriylev..neaaiafYeklGFevvgele
00532921   1/1  pelvGfaglrpidspggggvaeigylavdpeyrgkGiGraLlealleyarelglkrivlevlpdNeaair
00472801   1/1  gelvGfaglrplpdpvlglggvaeigdlavdpeyrgkGiGraLleallelarelglrrlvlev..neaai
00513771   1/1  Gfaglrpid.agegvaeigylavdpeyrGkGiGtallealleyafrelglrrlvlevdadNeaairlyek
00512481   1/1  ld...pdvaeigrlaVapeyrgkGiGkaLleallelarelglkrlvlevladntaaialYeklGFevvge
00514211   1/1  lrpiddgplglgvaei.glavdpeyrgkGiGtaLlealleyarelglrrlvlevdpdNeaairlyeklGF
00458961   1/1  rpl..pggdvaeigrlaVdpeyRGkGiGraLlealleearerglkriylevledNeaadeslirfYekl.
00530761   1/1  lds..gdvaelgdlaVapearGrGiGraLlealeelarerlgarrlrlevledNaaaialYeklGFepvg
00490311   1/1  aglrpidslllgggvaeigylavdpeyrgkGiGraLlealleyarelglkrlvlevlpdNeaairlYekl
00501851   1/1  aglrpiddgpagggvaei.glavdpeyrgkGigtallealleyarelglrrlvlevdpdNeaairlyekl
00526641   1/1  rpldslllgggvaeigglavdpeyrgkGiGraLlealleyarerglrrlvlevlpdNeaairlYeklGFe
00498841   1/1  eplvGfaglrpidsegggvaeigglavdpeyrgkGiGraLlealleyarelglkrivlevlpdNeaair-
00513031   1/1  p..dgdepvaeigrlaVdpeyrgkGiGraLlealleyareelglrrlvlev..dneairfYeklGFeevg
00514201   1/1  d...ggvaeigrlavdpeyrgkGiGraLlealleyarelglrrlvlevladNeaairfYeklGFevvgel
00459861   1/1  faglrplddlplgldvaeigdlavdpeyrgkGiGraLleallelarelglkrlvlevladNe--------
00496411   1/1  ddgelvGfaglrpldsllalpgggvaeigylavdpeyrgkGiGraLlealleyarelglrrlvlevdpdN
00512321   1/1  g...gdvaeigdlaVlpeyrgkGiGsaLlealleyakelglkriylevladnpaiklYeklGFvpvgelk
00520401   1/1  pldsllllgggvaeigrlavdpeyrgkGiGraLleallelarelglkrlvlev..npaairfYeklGFev
00480841   1/1  rvvGfaallplrlliggrggrvgyiegvaVhpdyRGqGlGsaLldaaeeeare.garrlvLev..naaar
00461771   1/1  vGfarlrpdgde..rvaeigrlaVdpeyrgkGiGraLleallelarerglkrlvlev..dneairfYekl
00528741   1/1  aglrpiddeplggvaei.glavdpeyrgkGiGtallealleyarelglkrivlevdpdNeaairlyekl-
00525221   1/1  alslldstlagrdvaeiedlyVapeyrgqGiGkaLleallelarergakrlrlevladNeaAirlYeklG
00523471   1/1  elvGfaglrpiddgpggklvaeigglavdpeyrGkGiGtaLlealleyarerglrrlvlevdpdNeaair
00507331   1/1  faglrpdddetgggrpvaeigylavdpeyrgkGiGraLlealleyarelg.rrlvlevladNeaairlYe
00481741   1/1  pldde.grvaeigylavdpeyrgkGiGraLlealleyarelglrrlvlevlpdNeaairlyeklGFevvg
00484331   1/1  lflvaeddgelvGfaglrpidde.ggvaei.glavapeyrGkGiGtellralleyafrelglrrlvlevl
00437121   1/1  rllgtfvaltrdidhytnfylilsedlakleellkaldlidwsqgllisslnlrlievikelaaskglkv
00527541   1/1  dgelvGfvglrpid..eggvaeig.lavapeyrGkGigtellealleyafellglrrlvlevladNeaa-
00517771   1/1  illylefs..gdvaeiellyVdpeyRgqGigtaLlealeewakelga-----------------------
00527011   1/1  l..rpdpdggvaeigylavlpdyrgkGigtellralleyarelglkrlvatvdpdNtasirlyeklGFel
00431281   1/1  rpldddvaeieslaVdpeyrgqGiGkkLlealleyarelglkrill....npaaikfyeklGFevvgelk
00526521   1/1  lvfaiedkedgeliGfiglrridpen..gtaeigywlapeyqgkGyatealkalldyafeelglh-----
00493381   1/1  vieddgelvGfiglrridpen..gtaeigywvdpsyrGkGiatealkalldyafeelglrrieat-----
00513261   1/1  eyledlladphslpliaeldgepvGyvelywvkedelgyyydaepgdrgihlligdpdyrgkGlgtal--
00492191   1/1  tvRllpttgplmlgdlysellfdlllplgpdvaeigRlaVdpeyrgkgglpligrlLlaalieyarel..


                         +         -         -         -         -         *         -:210
query           MMRKKLK---------------------------------------------------------------
00519151   1/1  eklGFev---------------------------------------------------------------
00488761   1/1  lyydg-----------------------------------------------------------------
00512521   1/1  iedyyd----------------------------------------------------------------
00469881   1/1  klGFee----------------------------------------------------------------
00528291   1/1  lplygg----------------------------------------------------------------
00509401   1/1  vvgev-----------------------------------------------------------------
00502231   1/1  lGFe------------------------------------------------------------------
00528581   1/1  elGlk-----------------------------------------------------------------
00461581   1/1  airfYe----------------------------------------------------------------
00514371   1/1  vgelpl----------------------------------------------------------------
00514931   1/1  lGFevv----------------------------------------------------------------
00498041   1/1  yare------------------------------------------------------------------
00493111   1/1  eevgr-----------------------------------------------------------------
00514921   1/1  Feas------------------------------------------------------------------
00527131   1/1  ----------------------------------------------------------------------
00527041   1/1  fYeklG----------------------------------------------------------------
00486741   1/1  lppl------------------------------------------------------------------
00490321   1/1  plyygi----------------------------------------------------------------
00517511   1/1  vevgel----------------------------------------------------------------
00513751   1/1  elvgel----------------------------------------------------------------
00518301   1/1  lyygg-----------------------------------------------------------------
00532921   1/1  lYek------------------------------------------------------------------
00472801   1/1  rfYe------------------------------------------------------------------
00513771   1/1  lGFee-----------------------------------------------------------------
00512481   1/1  ledyyg----------------------------------------------------------------
00514211   1/1  eevgelr---------------------------------------------------------------
00458961   1/1  F---------------------------------------------------------------------
00530761   1/1  elpdyyld--------------------------------------------------------------
00490311   1/1  GFedp-----------------------------------------------------------------
00501851   1/1  GFelvgel--------------------------------------------------------------
00526641   1/1  vvgel-----------------------------------------------------------------
00498841   1/1  ----------------------------------------------------------------------
00513031   1/1  elp-------------------------------------------------------------------
00514201   1/1  pdyyldg---------------------------------------------------------------
00459861   1/1  ----------------------------------------------------------------------
00496411   1/1  eaairfYek-------------------------------------------------------------
00512321   1/1  ly--------------------------------------------------------------------
00520401   1/1  vg--------------------------------------------------------------------
00480841   1/1  rfYerlG---------------------------------------------------------------
00461771   1/1  GFevvge---------------------------------------------------------------
00528741   1/1  ----------------------------------------------------------------------
00525221   1/1  Feevg-----------------------------------------------------------------
00523471   1/1  lYekl-----------------------------------------------------------------
00507331   1/1  klGFevv---------------------------------------------------------------
00481741   1/1  elrdyy----------------------------------------------------------------
00484331   1/1  adNeaairl-------------------------------------------------------------
00437121   1/1  ellra-----------------------------------------------------------------
00527541   1/1  ----------------------------------------------------------------------
00517771   1/1  ----------------------------------------------------------------------
00527011   1/1  vgelrlp---------------------------------------------------------------
00431281   1/1  lyyginge--------------------------------------------------------------
00526521   1/1  ----------------------------------------------------------------------
00493381   1/1  ----------------------------------------------------------------------
00513261   1/1  ----------------------------------------------------------------------
00492191   1/1  girrlv----------------------------------------------------------------