[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cper0:BAB80734.1


[Show Plain Result]

## Summary of Sequence Search
   1::113
   5::107  6.5e-25 37.3% 0048489 00484891 1/1   like                                    
   1::113


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRNEFKGSFLKIFIDESDKYNGEPLYLEILKVLKKENILGATVIRGIEGLDSHHKIHSDFIEILARNLPI
00484891   1/1  ----mdaklLriylgesdrlggrplyeallellreagiagatvlrgiaGfgasgrlhsahllelsldlPv


                         -         -         *         -         -         -         -:140
query           VIEVIESKEKINELIELIEPMIETGTITVIDNIQVISLNKKTD---------------------------
00484891   1/1  vvelvdteekieallelleellvdglvtled.vevvr---------------------------------