[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cper0:BAB81021.1


[Show Plain Result]

## Summary of Sequence Search
   1::301
  94::293  1.8e-44 37.6% 0046457 00464571 1/1   thione synthetase ATP-binding domain-li 
  95::293  4.8e-44 35.5% 0047408 00474081 1/1   thione synthetase ATP-binding domain-li 
  94::293  5.6e-43 35.0% 0037006 00370061 1/1   thione synthetase ATP-binding domain-li 
  85::293  2.6e-40 34.3% 0047322 00473221 1/1   thione synthetase ATP-binding domain-li 
  62::297  4.2e-36 32.3% 0050408 00504081 1/1   thione synthetase ATP-binding domain-li 
  93::292  8.9e-36 30.9% 0046656 00466561 1/1   thione synthetase ATP-binding domain-li 
  95::292  1.9e-35 31.6% 0044434 00444341 1/1   thione synthetase ATP-binding domain-li 
  94::303  3.1e-35 31.9% 0038251 00382511 1/1   thione synthetase ATP-binding domain-li 
  94::293  3.5e-35 29.2% 0044852 00448521 1/1   thione synthetase ATP-binding domain-li 
  94::293  1.4e-34 29.4% 0036618 00366181 1/1   thione synthetase ATP-binding domain-li 
  84::298  3.1e-33 34.4% 0035215 00352151 1/1   thione synthetase ATP-binding domain-li 
  95::296  7.6e-30 32.3% 0044272 00442721 1/1   thione synthetase ATP-binding domain-li 
   1::93   1.9e-29 45.2% 0046456 00464561 1/1   P-grasp domain                          
   1::94     2e-29 47.3% 0047407 00474071 1/1   P-grasp domain                          
   1::93   2.2e-29 45.2% 0046561 00465611 1/1   P-grasp domain                          
  97::282  4.2e-23 27.8% 0034972 00349721 1/1   thione synthetase ATP-binding domain-li 
  94::289  1.6e-20 28.8% 0035376 00353761 1/1   thione synthetase ATP-binding domain-li 
  93::296  4.2e-15 29.0% 0038243 00382431 1/1   thione synthetase ATP-binding domain-li 
  91::270  5.1e-15 25.9% 0045447 00454471 1/1   thione synthetase ATP-binding domain-li 
  90::293  1.1e-09 23.6% 0046632 00466321 1/1   thione synthetase ATP-binding domain-li 
  94::262  4.8e-07 21.4% 0045751 00457511 1/1   thione synthetase ATP-binding domain-li 
   1::301


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKVGVIMGGISSEREISIQSGNSVVHALDKDKYEAIPIVLNEKEDLIEKVKGIDFALLALHGKFGEDGTV
00464571   1/1  ----------------------------------------------------------------------
00474081   1/1  ----------------------------------------------------------------------
00370061   1/1  ----------------------------------------------------------------------
00473221   1/1  ----------------------------------------------------------------------
00504081   1/1  -------------------------------------------------------------Gflienail
00466561   1/1  ----------------------------------------------------------------------
00444341   1/1  ----------------------------------------------------------------------
00382511   1/1  ----------------------------------------------------------------------
00448521   1/1  ----------------------------------------------------------------------
00366181   1/1  ----------------------------------------------------------------------
00352151   1/1  ----------------------------------------------------------------------
00442721   1/1  ----------------------------------------------------------------------
00464561   1/1  kklkvavlfGGlssEhevSllSaaavlkaLdkekyevllilidkdglwlllellllllllddllllllll
00474071   1/1  lklkvavlfGGlsserevsllsaaavlkaLdklgyevvlididkdllllllllkvdvvfpllhGllGedG
00465611   1/1  klkvavlfGGlssEhevSllSaaavlkaLdklekyevllilidkdglwllldllllllllksllllllll
00349721   1/1  ----------------------------------------------------------------------
00353761   1/1  ----------------------------------------------------------------------
00382431   1/1  ----------------------------------------------------------------------
00454471   1/1  ----------------------------------------------------------------------
00466321   1/1  ----------------------------------------------------------------------
00457511   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           QSVLKTLGIPFSGCGPLSSAICMDKDMTKRILAFGNVRTARWEMVSSVDEIDYEKIENLGYPVFVKPNNG
00464571   1/1  -----------------------DKlltklllaeagipvppgvlvtsleea...aaeelgyPvvvKparg
00474081   1/1  ------------------------Kllakqllaeagipvppgvlvtssdlllldleeal.aaaeelgyPv
00370061   1/1  -----------------------DKvlakellakagipvppgvvltsleellllaleaaeelgyPvvvKp
00473221   1/1  --------------NspeairlagdKllakellaka.iptppglplptllvtsleea.lefaeelgyPvv
00504081   1/1  aqvlevagipl..........agdkvlakellkkagipvaPdllyegavvtsleea.leaaeeigyPvvv
00466561   1/1  ----------------------gDKllakellaeagiptppyalvtsleea.leaaeeigyPvvvKpagg
00444341   1/1  ------------------------Kllakellakagipvppgllavatsleea.laaaeelgyPvvvKpa
00382511   1/1  -----------------------DKllakellakagiptppggvatsveeal.aaaeeigyPvvvKpsgg
00448521   1/1  -----------------------dkylakellkkagiptpkgavatspeea.leaaeeigyPvvvKpsgg
00366181   1/1  -----------------------DKllakellakagipvppglllavvtsleeal.aaaeeigyPvvvKp
00352151   1/1  -------------nspeaialamdKlltkkllaklqkklglagvpvpptsil...ed.akelaeklgyPv
00442721   1/1  ------------------------Kllakellakagipvpptlvatsleea.laaaeeigyPvvvKplyg
00464561   1/1  elllllllllllllllllevdvv-----------------------------------------------
00474071   1/1  tlqgllellgiPytgsgvlasala----------------------------------------------
00465611   1/1  llllllgllllllllgllllevd-----------------------------------------------
00349721   1/1  --------------------------lfkelleelgiptpkyavatsleeal.aaaeeigyPvvvKp...
00353761   1/1  -----------------------Dkllakelleklglptapyalvdsleel.laaaeelgyPvvvKparg
00382431   1/1  ----------------------gdKlllaka....glpvPptlvasdleea.lefleelg.pvvlKpldg
00454471   1/1  --------------------laldkyeakellakagipvppggvatspeea.veaaeeigyPkvVvKasv
00466321   1/1  -------------------rlaldeyqakellkeygipvpkgivatsaeea.leaaeelgykpvVvKaqv
00457511   1/1  -----------------------drelfsklldelglkqpesliatsleea.lelaeeigyPvlvrPsyv


                         +         -         -         -         -         *         -:210
query           GSSVATTLVESKEAVKDAVLEALKYDTEVMIEEYIKGDEITCPIIDGKMLPVLAIKPKGKFFDIASKYGD
00464571   1/1  gggkGvsivrseeeleaaleealegddevlvEefiegreievlvlgdggevvvlpvveiipgngiydgea
00474081   1/1  vvKpaaggggkGvsvvrneeeleealelalegddevlvEefiegreievlvlgdgvlpvvelvdpkgfyd
00370061   1/1  aagggGkGvsvvkneeeleealeeaffydsevlvEefiegarEievqvlgdgkgnvvvlgerecslqrrh
00473221   1/1  vKpaggggGkGvrivkneeeleaaleealseddpvlveefiegpreirvlvlgdgvlpaierspeggfl.
00504081   1/1  KpsrggggrGvrivkseeeleaaleealaespgspvlveefiegareyevdvladgdgevvalgirec..
00466561   1/1  ggGkGvrvvrseeeleaaleealeeslfgdgevlvEefiegareisvlvlrdgdgvvi.......fevde
00444341   1/1  gggggrGvrvvkseeeleealeealgealagfgddpvlvEeflegareievlvlgdgegavvll....ge
00382511   1/1  ggGkGvrvvrseeeleealeealgealagsgdgevlvEeflegreisvlvlgdgggvvvlavaerhqkvg
00448521   1/1  agGrGvvvvkseeeleealeealgealvgsgdgpvlvEeflegrEisvlvlrdgegvvvliiasdhggvy
00366181   1/1  aggggGkGvrvvrdeeeleealeealeealagsgdgpvlveeflegareievlvlgdgegvvi..llger
00352151   1/1  vvKplyggsGkgvvkveneeeledalelaalldspvlveefidggrdirvqvlgdkvvaavrrii...eg
00442721   1/1  ggGrgvrlvrdeeeleaaleealeeaasgdgpvlveeflegpereirvlvvgdevvaavirrh....gdv
00464561   1/1  ----------------------------------------------------------------------
00474071   1/1  ----------------------------------------------------------------------
00465611   1/1  ----------------------------------------------------------------------
00349721   1/1  Gvsvvyneeeleeal..........dhpvlveeflegakEvsvdvvrdgggvv.ilgiiehieeagvhtg
00353761   1/1  gYgGkgvsvvkseeeleaale....gdgevlvEefvegdreisvlvlrdgdgevv.......fyplveni
00382431   1/1  sgGrgvflvededelldaleelltlsgngpvlvqeylpgikegdirvlvvggevvaailrrvpag..gdf
00454471   1/1  glgGrgkaGGvrlvkseeeleeaaeellgevlvtlqtalagspvdgvlveefldgarElyvgvvrdrvfg
00466321   1/1  lagGrGkailhksdvGGVklvlsleeakeaaeeilgkvlvtkqtglaglpvngvlveefldgarElylgi
00457511   1/1  lgGrgmeivyneeeLeeyleealkvsplhpvlidkfllgakevevdvvrdlgdnviivgimehiepaGvh


                         -         -         -         +         -         -         -:280
query           GGADEFIVELNEDLHKEVEKMALETYKLLKCDVYARVDMLVKDNIPYVLEVNTLPGMTKNSLFPKSAAGI
00464571   1/1  kyslgrrhqksievapaplsdelleelrelalkaakalglrglarvdffvdedgevyvlEvNprpgltgh
00474081   1/1  gdakyrtggvievapap.lsdelleeirelalkaakalglrgllgvdflldedgepyvlEvNtrpgltet
00370061   1/1  qkfydyeakyhtggsieeappadlsdelreeirelavkaakalgyrglarvdflldedgepyviEvNtrp
00473221   1/1  ........sntggpaalspelleeireialkaakalgyrgllgvdflldkdgepyllEvNprpglglveh
00504081   1/1  ...svgihtgdsievapaltlpdelleelreaalklakalglvgaggveflvdpkdgepyvlEvNpRpgg
00466561   1/1  nvqrngvhsgevapaplsdelleelreialkaaralgyvgllgveffvddgelyviEvnprpgvtgpvtl
00444341   1/1  rdesagvhtggvieeapaptlseelleeirelalkaakalgyrGllgvdflvdedgelyviEvNprpgvs
00382511   1/1  iedagvhtggsgavapaptltdelleeireiavkptldglaakalgyvgvlgveflldkdgepyviEvNp
00448521   1/1  iedvgvntggsiavapap.lseelleeireialkiakalgleglayvgllgveflltdgepyvlEiNprp
00366181   1/1  dhdagvhtggsieeapaptlseelleeirelalkaaralgyvGllgveflvddgelyvlEvNprpgvtgp
00352151   1/1  dwkanvh.ggslepap.....lseelrelalkaakalgglglagvdflvdkdgelyvlEvNtrpgleglv
00442721   1/1  iaevhaggsalvap.....lteelrelalkaakalgl.glagvdflvddgelyvlEvNprpgvtgp....
00464561   1/1  ----------------------------------------------------------------------
00474071   1/1  ----------------------------------------------------------------------
00465611   1/1  ----------------------------------------------------------------------
00349721   1/1  dsgvvlppatlsdelleelreiakkiaralglrGllnvdffvtddevyviEvNprpsrt..vplvskatg
00353761   1/1  qrngilvgsvaPaplsdelleeareialkiaealgyvGvlgveffvtgdgllvnEvnprphnsghvtlla
00382431   1/1  rsnlalggsaeaap.....lteelrelalkaaralkelgl.gfvgvDii...g.pyvlEvNvrsppg..f
00454471   1/1  nvvll.........gsmeGGvdiesvgrhsgdlievapadaltgllrerarelalklgla----------
00466321   1/1  lldrafgvvlliasgeGGvdiEevadvapelipkivvdalegltdeiarkllkglglpgvdieglaefll
00457511   1/1  sGdsivvlPpqtlsdeelerlrdatlkiaralgvevGllnvqfaldpkdgel------------------


                         -         *         -         -         -         -         +:350
query           NMSFEELLDTIIEKSLKVNRE-------------------------------------------------
00464571   1/1  slvpllakatgid---------------------------------------------------------
00474081   1/1  slvpvtekatgid---------------------------------------------------------
00370061   1/1  gvtgtslhpvtek---------------------------------------------------------
00473221   1/1  ppleaalgidlfe---------------------------------------------------------
00504081   1/1  ehp.ltekat.gvdl.v-----------------------------------------------------
00466561   1/1  k....atgidla----------------------------------------------------------
00444341   1/1  gpvtekatgidl----------------------------------------------------------
00382511   1/1  rpgdpehpvvlkat.gidl.ael-----------------------------------------------
00448521   1/1  gdtehpllelat.---------------------------------------------------------
00366181   1/1  vtekatgidlvel---------------------------------------------------------
00352151   1/1  ......tgidl.akliak----------------------------------------------------
00442721   1/1  ekatgidl.aelilrl------------------------------------------------------
00464561   1/1  ----------------------------------------------------------------------
00474071   1/1  ----------------------------------------------------------------------
00465611   1/1  ----------------------------------------------------------------------
00349721   1/1  vs--------------------------------------------------------------------
00353761   1/1  tgislfelh-------------------------------------------------------------
00382431   1/1  lgielatgidl.aeli------------------------------------------------------
00454471   1/1  ----------------------------------------------------------------------
00466321   1/1  nlyllfvdldatl---------------------------------------------------------
00457511   1/1  ----------------------------------------------------------------------