[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cper0:BAB81104.1


[Show Plain Result]

## Summary of Sequence Search
   1::235
   1::237  1.6e-95 54.4% 0046520 00465201 1/1   e and uridine phosphorylases            
   1::235  4.3e-86 53.4% 0041801 00418011 1/1   e and uridine phosphorylases            
   2::234  1.1e-85 51.1% 0039496 00394961 1/1   e and uridine phosphorylases            
   1::237  1.1e-76 42.2% 0050186 00501861 1/1   e and uridine phosphorylases            
   1::235  2.3e-76 45.9% 0048860 00488601 1/1   e and uridine phosphorylases            
   2::232    1e-73 38.5% 0051743 00517431 1/1   e and uridine phosphorylases            
   1::234  5.5e-73 35.9% 0049568 00495681 1/1   e and uridine phosphorylases            
   1::236  3.7e-72 40.8% 0047738 00477381 1/1   e and uridine phosphorylases            
  14::237  1.3e-63 41.9% 0039819 00398191 1/1   e and uridine phosphorylases            
   1::235  1.5e-59 35.2% 0051268 00512681 1/1   e and uridine phosphorylases            
  13::235  3.4e-52 36.2% 0048936 00489361 1/1   e and uridine phosphorylases            
  11::236  2.1e-43 26.5% 0050047 00500471 1/1   e and uridine phosphorylases            
   1::236  3.3e-41 24.4% 0045902 00459021 1/1   e and uridine phosphorylases            
  10::235  2.6e-31 23.3% 0050257 00502571 1/1   e and uridine phosphorylases            
   3::236  2.3e-30 23.7% 0048112 00481121 1/1   e and uridine phosphorylases            
  20::236  1.9e-25 23.7% 0046099 00460991 1/1   e and uridine phosphorylases            
   4::235    6e-20 23.0% 0046908 00469081 1/1   e and uridine phosphorylases            
   1::235


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSIHIGAKEGQIAETILLPGDPLRAKFIAETFLENPVCYNEVRGMLGYTGTYKGKRISVQGTGMGVPSIS
00465201   1/1  ltphigakkgdiaelvllpGdPlRakliAetflenaelvnevrelllytgtykgkkisvvstGiGiPsas
00418011   1/1  mtyhigakkgdiaevvllpgdplrvkliaetlldnvvlvnevrgyliytgtykgkrvsvvstgiGkpsaa
00394961   1/1  -tyHlglkkgdiakvvllpgdplrvkliae.llenaelvnevrgyliytgtykgkrvsvvshgiGipsaa
00501861   1/1  ltyhlgakkgdvakiviiggdpervkllaellleevvlvtevrgflfytgtykgkpvvvvstgiGkpsaa
00488601   1/1  gltyhlglkpgdiakivilvgdplrvkllae.lledvelvadvrgfltytgtykgkkvsvvstgiGkpsa
00517431   1/1  -tyhlglkkgdiakiviiggdplevellaellldevelvldirgfpfytgtlkgkevvvvstgiGkvnaa
00495681   1/1  tdaaaaverllelyersvkllrdalaalleggllpdedleerlravYPelrlttdgelaevdsrlafGlv
00477381   1/1  ledgllyhlglkpgdiglakiviiggdplrvkllae.lledvelvtdirgfpfytgtlkgkpvvvvstGi
00398191   1/1  -------------mkiviivAlpleakalae.lledve.vnevrgmlyytgtykgkevvvvltgiGkvna
00512681   1/1  eeldlsldlltlhlglklgdiakivligglpleadalaelld......ieyrgiplytgtlggknvvlvr
00489361   1/1  ------------lllesslllllelleeaaelildllgllkpkigiIgGsglgeladllldalveipyet
00500471   1/1  ----------lvpkiaiigGsglgvliiledipefpvstvaghpsgklvlgtlggkpvvflarhGrghly
00459021   1/1  lllllelleeaaahikaklglvpkigiigGsglgdladaleeevetpygeipdfpvstveghsgklvtgt
00502571   1/1  ---------llekleeaaelllsklglkpkigiigGsGlgdladaleeevetpyge.....ipgfpvstv
00481121   1/1  --lsllllekleeaadlllsklglrpkigiigGsGlgdladaleeevetpygei.....pdfpvstvegh
00460991   1/1  -------------------kpkigiIgGSGlgdleilllleilyvetpfgp...hsgklvlgtlggvpvv
00469081   1/1  ---lllekleeaadlilsktgllapkigiigGsglgdllelleevevetpygeipgfpvstvaghsgkl.


                         -         -         *         -         -         -         -:140
query           IYVNELIRDYGVKNLIRVGTAGGMQEDIKVRDLVLAMSSHTDSAINKVRFNGLDFAPTASFKLLKAAYDT
00465201   1/1  iyveeLiallgvktliRvGtaGalqpdvklgdlviatgAvrlsglsrlyflgldypavadfelllalvea
00418011   1/1  ivleeLia.lgvkaiirvGtaGalqpdlkvgdlviataavrddgtsllylppldypavadfelldalvka
00394961   1/1  ivleeLi.lygvktiIrvGtaGalqedlkvgdvviataavrddgdtslfylplgqpypavadfelldalv
00501861   1/1  ialeeliallgvkliiriGtaGaldpdlkvgdvviataavrhdgdsafgylpgevpavadpelleallka
00488601   1/1  aivleeLi.llgvktiiriGtaGalqpdllkvgdvviataavrddgtsfgylpg.eypavadpellealv
00517431   1/1  ialeeliallgvktiiriGtaGgldpdlkvgdvviataairldgtspgylpgvdypapadpelleallea
00495681   1/1  alpGvyattvtrPdlfrdylleqlglllrnygvpvevglsdteiPlpfaldggdlledgllalelrdlfd
00477381   1/1  Gkpnaaiaveelia.lgvktiiriGtaGgldpdlkvgdvviataairldgtsfgylpg.dvpapadpell
00398191   1/1  aiattelialfgvdliirvGtAGgldpdlkvgDvvvatgvvqhdvdatgfgyelgqfpglplafaadlal
00512681   1/1  tgiGkvnaaialreli.llgvkliirvGaaGglnpdlklGdvviaddaidydggsllvl.gvefpapadp
00489361   1/1  ipgfpsltvkfhagt.l.....ggevrgvlarhG......ighlyegigvnaarani.ellkalgvktii
00500471   1/1  ephkvnyraniraLk.alGvktliatgaaGslnedlkpgdlvipddhidltggrpltffngggvrhvdma
00459021   1/1  lggvpVvvflgrhGkyegaiptevnyranllkllgvetliatgaaGglnpdlkpgdlviiddhidltgdr
00502571   1/1  eghsgklvlgtlggkpvvlrhGrfhlyeghglvnaranvraLka.lgvetliatgaaGglnpdlkpgdlv
00481121   1/1  sgklvlgtlggkpvvvflgrhGkyegaiptevnyranllkllgvdtliatgaaGglnpelkpgdlviidd
00460991   1/1  flarhGrghlyephkvnyraniralke.lgvetliatgaaGglnedlkpgdlviiddhidltgdrdltfl
00469081   1/1  vfgtlggvpvvf.rhGrghlyeghsvnyralniralkllGvevliatnaaGglnedlkpgdlvliddhid


                         +         -         -         -         -         *         -:210
query           AVEKGYSPKVGSVFTADSFYNDNPEAWKQWAKFGTLAVEMETAALYTLAAKYGVNALTILTISDHLITAE
00465201   1/1  akelgikvhvGivlssdlFYagqerllellkklgvlavemEaaaLftlaallglkalavltvsdnlltge
00418011   1/1  aeelglkvhvGlvastdgfyreteeklrllkklgalavEMEaaalaalaallgvpalailtvsdnlltge
00394961   1/1  eaakelglkvhvGlvastdsfyreqerllkllkklgvlavEMEaaalaalaallgvkalvvltvsdnlll
00501861   1/1  akelgikvhvGliastdgfyaeterllkllkkfgvlavEMEaaalaavaallgvpalailtvsdnalgge
00488601   1/1  eaaeelgikvhvGvvvttdgfyretgrpeklellrklgalavEMEsaalaavaallgvpalailtvsdnl
00517431   1/1  akelgikvhvGviattdgfyaeteaelrllkklgalaveMEtaalaavAallgvpalairavsDladgee
00495681   1/1  lpdLaliddeianGlllpgeplplalftalrvdlslarlehytgtavehfqnyvlltnyqfyvdefielt
00477381   1/1  ealleaakelgikvhvGvvattdgfyretgrldglllsfpellpallrllrklgalaveMEsaalaavaa
00398191   1/1  lkaalkaakelglkvhvgliasgdsfvadaearlellklfpgalaveMEaaavaqvAalfgvpflvirai
00512681   1/1  ellealleaakelgikvheGtiasgdgfyfetpaeirellrklgadaveMEaaalaavArelgipflvir
00489361   1/1  rtGaaGglnpdlkpgdlviatdaidldgds..tlfgvrfpdladp.ldkalreaakelgikvheGtyatt
00500471   1/1  apydpelrellleaakelgikvhvggvyvvvsgPrfe..tpaeirmlrselgadavgMttapeailArel
00459021   1/1  dvtpligpnlerggvrfvdmsapydpelrellleaaeelgikvhlregvyvvvsgPrfe..tpaeirmlr
00502571   1/1  liddhidltggrpltgfndglfgvrfvdmsdpydpelrellleaak...lregvyvvveGPrfe..tpae
00481121   1/1  hidltggrtatfligpnlerggvrfvdmsdpydpelrellleaakelgikvhlregvyvvvsGPrfe..t
00460991   1/1  igpnderggvrhvdmadpydpelrellleaakelgikvhrggvyvvveGPrfe..tpaeirllrslgada
00469081   1/1  ltggrpltgfnfvdmsdpydpelrellleaake....lreGvyvcveGPrfetpaeirmlrllGadaVgM


                         -         -         -         +         -         -         -:280
query           ETTSEERQTTFTKMMEVALDAAITL---------------------------------------------
00465201   1/1  llsaeereetfnemievaleaallnkl-------------------------------------------
00418011   1/1  alsaeerlelflkmieialeallkl---------------------------------------------
00394961   1/1  tgeittseelllafknmielllei----------------------------------------------
00501861   1/1  alsfeefletvakmielalelllkllk-------------------------------------------
00488601   1/1  lggelvllfeefleeaaekaieial---------------------------------------------
00517431   1/1  alsfeefletaakasaialell------------------------------------------------
00495681   1/1  philakpgdiakiviipadpeevd----------------------------------------------
00477381   1/1  llgvpalairvvsdnaltgellsfee--------------------------------------------
00398191   1/1  sDladeganldweeflalaakmsalal-------------------------------------------
00512681   1/1  gvsDyadghenvdweevlaaaaaaa---------------------------------------------
00489361   1/1  dgfyfetpaeirllrklgadaveME---------------------------------------------
00500471   1/1  glpyaaislvtdyaagieepvtheev--------------------------------------------
00459021   1/1  llgadavgMstapeailArelglpya--------------------------------------------
00502571   1/1  irllrllgadaVgMstvpeailAre---------------------------------------------
00481121   1/1  paeirllrllgadavgMstapeailA--------------------------------------------
00460991   1/1  vgMttvpeailArelglpyaaislvt--------------------------------------------
00469081   1/1  stvpeailArelglpyaaislvtdy---------------------------------------------