[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cper0:BAB81143.1


[Show Plain Result]

## Summary of Sequence Search
   1::400
   1::152  9.4e-35 34.3% 0047033 00470331 1/1   myl tRNA-reductase catalytic, N-termina 
 173::300  6.6e-18 23.4% 0047032 00470321 1/1   )-binding Rossmann-fold domains         
 173::338  1.5e-16 20.7% 0048469 00484691 1/1   )-binding Rossmann-fold domains         
 173::339  2.2e-15 22.4% 0048455 00484551 1/1   )-binding Rossmann-fold domains         
 173::338    1e-12 21.1% 0042180 00421801 1/1   )-binding Rossmann-fold domains         
 173::338  1.9e-10 19.3% 0048416 00484161 1/1   )-binding Rossmann-fold domains         
 173::312    2e-08 14.0% 0050910 00509101 1/1   )-binding Rossmann-fold domains         
 170::308    9e-07 18.1% 0050241 00502411 1/1   )-binding Rossmann-fold domains         
 173::274    2e-06 18.6% 0048414 00484141 1/1   )-binding Rossmann-fold domains         
 173::292  2.1e-06 20.5% 0051797 00517971 1/1   )-binding Rossmann-fold domains         
 173::330  3.1e-06 15.5% 0036785 00367851 1/1   )-binding Rossmann-fold domains         
 173::260  8.1e-06 22.4% 0047516 00475161 1/1   )-binding Rossmann-fold domains         
 173::243  9.6e-05 22.5% 0050228 00502281 1/1   )-binding Rossmann-fold domains         
 173::243  0.00012 22.5% 0052722 00527221 1/1   )-binding Rossmann-fold domains         
 173::246  0.00022 23.2% 0052329 00523291 1/1   )-binding Rossmann-fold domains         
 173::261  0.00035 23.9% 0049686 00496861 1/1   )-binding Rossmann-fold domains         
 173::242  0.00085 21.7% 0048186 00481861 1/1   )-binding Rossmann-fold domains         
 173::245  0.00094 17.1% 0050269 00502691 1/1   )-binding Rossmann-fold domains         
   1::400


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MIGVIGVKRNVDIAIREKLALYPKKHKKYVGELLNSFKEVVILNTCNRTEIYFNCTEEISEDEIFDKIFN
00470331   1/1  lmsllvvglnhktapvelreklafseeealelllsl.egieeavilsTCnRtEiylvaddl.........
00470321   1/1  ----------------------------------------------------------------------
00484691   1/1  ----------------------------------------------------------------------
00484551   1/1  ----------------------------------------------------------------------
00421801   1/1  ----------------------------------------------------------------------
00484161   1/1  ----------------------------------------------------------------------
00509101   1/1  ----------------------------------------------------------------------
00502411   1/1  ----------------------------------------------------------------------
00484141   1/1  ----------------------------------------------------------------------
00517971   1/1  ----------------------------------------------------------------------
00367851   1/1  ----------------------------------------------------------------------
00475161   1/1  ----------------------------------------------------------------------
00502281   1/1  ----------------------------------------------------------------------
00527221   1/1  ----------------------------------------------------------------------
00523291   1/1  ----------------------------------------------------------------------
00496861   1/1  ----------------------------------------------------------------------
00481861   1/1  ----------------------------------------------------------------------
00502691   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           VFNWNDDLKKYMFLSKEKRAVTHLMEVICGFHSRILGEDQILGQIKDAYKTAISDNSISSELQKMFEIAI
00470331   1/1  ..llgllleellellyvlegeeavrhlfrvasGLdSlvlGEdqIlgQvkeayelalelgtlgllLnrlfq
00470321   1/1  ----------------------------------------------------------------------
00484691   1/1  ----------------------------------------------------------------------
00484551   1/1  ----------------------------------------------------------------------
00421801   1/1  ----------------------------------------------------------------------
00484161   1/1  ----------------------------------------------------------------------
00509101   1/1  ----------------------------------------------------------------------
00502411   1/1  ----------------------------------------------------------------------
00484141   1/1  ----------------------------------------------------------------------
00517971   1/1  ----------------------------------------------------------------------
00367851   1/1  ----------------------------------------------------------------------
00475161   1/1  ----------------------------------------------------------------------
00502281   1/1  ----------------------------------------------------------------------
00527221   1/1  ----------------------------------------------------------------------
00523291   1/1  ----------------------------------------------------------------------
00496861   1/1  ----------------------------------------------------------------------
00481861   1/1  ----------------------------------------------------------------------
00502691   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           ACGKKFKTECKMFEVPVSSVSISINSALLKGCRKFMVLGYGEIGKLAIKHLLSHKVECIYLIVRDKSKAS
00470331   1/1  kaisvakrvrte----------------------------------------------------------
00470321   1/1  --------------------------------llGdntdglgavellerlggdlkgktvlviGaGgiGra
00484691   1/1  --------------------------------DgigavsllkrlgvdlpgkrvlviGaGgagraaalall
00484551   1/1  --------------------------------DgiGfvellkrlgvdlkgktvlitGAGgagraialala
00421801   1/1  --------------------------------DgigavsllkrllvdlpgkkvlvlGaGgiGralalala
00484161   1/1  --------------------------------DgiGfvellregldlkgkkvlviGaGgaaravaaalle
00509101   1/1  --------------------------------mkigiiGaGnmGralaagLlkaGhsevtvanrtpekae
00502411   1/1  -----------------------------kdaktlaiiGaGaqarlhlrallavrpieevrvwdrdpera
00484141   1/1  --------------------------------ktvliiGaGgvGlaiaqalaalGakkVvlvdrdeekaq
00517971   1/1  --------------------------------mkigiiGaGnmGsalakgllkaghevv.vadrspekae
00367851   1/1  --------------------------------kgkkvlviGaGgiGralaraLaeaGa.evtvadrslek
00475161   1/1  --------------------------------hgkkvgiiGlGniGkavakllkgfgmevlaydrrpke.
00502281   1/1  --------------------------------mmkvlitGAtGfiGselvrlLlehgdhevtaldrrtsa
00527221   1/1  --------------------------------llllkillslkgkkvlvtGAtGgiGralvkellargav
00523291   1/1  --------------------------------kkvgviGlGlmGlalalnlak.gfe.vvvydrtpekae
00496861   1/1  --------------------------------AasilllgltsylallevlkikegkkVlvtGAtGgiGl
00481861   1/1  --------------------------------kkvlvtGAsGgiGsalalllaarga.evvlldrspekl
00502691   1/1  --------------------------------kkvgiiGlGlmGlalarnlaaaGyeVvvy.drspekle


                         -         -         -         +         -         -         -:280
query           DLEGEIVEVLDFNEKNQVINEVDCIVSCTAAPHTVVRNEDIKTEGDIIHIYDLAVPRDVDKELSEKERVI
00470331   1/1  ----------------------------------------------------------------------
00470321   1/1  varalaaaGakrvvvanrtpekaeelaeelggeavsldelaealaeaDivinatpaglpvitlellepgl
00484691   1/1  alga.evtvvnrtlekaeelaelladevvaldlddleealggaDlvinatgagmaglv..lplllsllkp
00484551   1/1  klg..nvvianrtlekaealaeelgelggavkvdvldlddlaealggadilinatgagmpplledllpld
00421801   1/1  aaga.evvvvnrtlekaeelaeelgaqgdvsdleeleealggaDivvnatgaglpglllelllellkpgg
00484161   1/1  lgakkitivnrtlekaealaeefgvlatllea...laeadlvvnatpagmaplvlelllplllellkpgl
00509101   1/1  alaeeg..gvvaaslaealadadvvilavkpqaveevlaelag..kgalvidiaagipieelaealpeag
00502411   1/1  ealaarlaglgvevvdsleeavagaDvvvtaTpstepvldaewl.kpgahvlaigadapgkrEldpella
00484141   1/1  alveqlkelgskikvkavsldvgdveeleellgkvDivinaaglgepaklldllvellervksg------
00517971   1/1  elaeel.gvtaatsleelledaDvvilavp.pqlveevlkalkpgklvidvaagidiealaealkeggiv
00367851   1/1  aealaaelggveavelDvtdeasldaalgdaDvvinaapvglh..aeiveaaleagkhvvdenplaaetr
00475161   1/1  ..........gavyvsldellaesDvvvlcapl.eaineealaalkkgai--------------------
00502281   1/1  gkllnepgvevvegdltdpddlekalkgvDvvi-------------------------------------
00527221   1/1  skvialvRrpekleelaaegvevvvgDltdpes-------------------------------------
00523291   1/1  alaelgav...aaslaealaeadvvilavpapaavr----------------------------------
00496861   1/1  avvrlllkrGy.kViaidrseekleklkelgadvvldvtdveellkallkl-------------------
00481861   1/1  egvaldlsdlgvevvvadltdpeslaealkga--------------------------------------
00502691   1/1  alaal..gaevaaslaealadadvvilavplpaav-----------------------------------


                         -         *         -         -         -         -         +:350
query           LKDIDEISKIDDKNKKIRKERMEEYKHIVEESIEEFLNWLKIREVSSKIRNIKIRENEICSERIKTFSNK
00470331   1/1  ----------------------------------------------------------------------
00470321   1/1  llallkkgalvidlaypplv--------------------------------------------------
00484691   1/1  ggvvvdvgypplitpllalaravglrltvdgl..................emlveqaa------------
00484551   1/1  lalllkvnvvldlaytplvtpllkeakeaglivvdgl..................emlv-----------
00421801   1/1  vvvdvayppllttallplararglgrivdgl..................smlvlqgap------------
00484161   1/1  lvidiaygpletpllklaraaglrvvdGl..................emlvgqaaeaf------------
00509101   1/1  lvvrdmpnlgalvgagataltllaggdeeale--------------------------------------
00502411   1/1  radvvvDsleqaleagellqaleeglld------------------------------------------
00484141   1/1  ----------------------------------------------------------------------
00517971   1/1  vrvapntgalvg----------------------------------------------------------
00367851   1/1  alleaakeagvgrivnvssaagyadgrglpayqaakaalealllglalel--------------------
00475161   1/1  ----------------------------------------------------------------------
00502281   1/1  ----------------------------------------------------------------------
00527221   1/1  ----------------------------------------------------------------------
00523291   1/1  ----------------------------------------------------------------------
00496861   1/1  ----------------------------------------------------------------------
00481861   1/1  ----------------------------------------------------------------------
00502691   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           GNGENAKLAERMIKSTADAYVNRAIELLKSEALKGSDSSCAEIIEKIFLT--------------------
00470331   1/1  ----------------------------------------------------------------------
00470321   1/1  ----------------------------------------------------------------------
00484691   1/1  ----------------------------------------------------------------------
00484551   1/1  ----------------------------------------------------------------------
00421801   1/1  ----------------------------------------------------------------------
00484161   1/1  ----------------------------------------------------------------------
00509101   1/1  ----------------------------------------------------------------------
00502411   1/1  ----------------------------------------------------------------------
00484141   1/1  ----------------------------------------------------------------------
00517971   1/1  ----------------------------------------------------------------------
00367851   1/1  ----------------------------------------------------------------------
00475161   1/1  ----------------------------------------------------------------------
00502281   1/1  ----------------------------------------------------------------------
00527221   1/1  ----------------------------------------------------------------------
00523291   1/1  ----------------------------------------------------------------------
00496861   1/1  ----------------------------------------------------------------------
00481861   1/1  ----------------------------------------------------------------------
00502691   1/1  ----------------------------------------------------------------------