[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cper0:BAB81144.1


[Show Plain Result]

## Summary of Sequence Search
   1::326
 101::305  9.7e-25 29.7% 0035139 00351391 1/1   te reductase hemoprotein (SiRHP), domai 
 147::251  2.1e-22 36.0% 0052779 00527791 1/1   S ferredoxins                           
  99::236  2.5e-19 28.1% 0038470 00384701 1/1   S ferredoxins                           
  96::227    4e-17 33.6% 0040210 00402101 1/1   S ferredoxins                           
 130::237  1.9e-16 26.9% 0052034 00520341 1/1   -helical ferredoxin                     
 100::322  3.4e-16 22.7% 0035138 00351381 1/1   te reductase hemoprotein (SiRHP), domai 
 133::226  1.5e-15 37.4% 0045037 00450371 1/1   S ferredoxins                           
 166::226  1.8e-14 41.4% 0039666 00396661 1/1   S ferredoxins                           
 138::226  1.4e-13 37.3% 0047184 00471841 1/1   S ferredoxins                           
 167::235  1.7e-13 33.3% 0035446 00354461 1/1   S ferredoxins                           
 167::234  2.8e-13 35.4% 0047149 00471491 1/1   S ferredoxins                           
 141::226  5.4e-13 39.8% 0042562 00425621 1/1   S ferredoxins                           
  97::227  6.8e-13 28.2% 0044015 00440151 1/1   S ferredoxins                           
 154::234  9.1e-13 33.3% 0045859 00458591 1/1   S ferredoxins                           
 167::222  1.2e-12 45.3% 0053368 00533681 1/1   S ferredoxins                           
 134::223  1.3e-12 34.1% 0052928 00529281 1/1   S ferredoxins                           
 167::243  1.3e-12 32.4% 0049159 00491591 1/1   S ferredoxins                           
  99::227  2.5e-12 27.9% 0038361 00383611 1/1   S ferredoxins                           
 136::245  4.2e-12 27.1% 0047791 00477911 1/1   -helical ferredoxin                     
 121::230  4.5e-12 22.7% 0052774 00527741 1/1   S ferredoxins                           
 167::222  5.9e-12 47.2% 0039453 00394531 1/1   S ferredoxins                           
  25::83   7.4e-12 39.0% 0045800 00458001 1/1   te reductase, domains 1 and 3           
 162::225  9.5e-12 37.5% 0037513 00375131 1/1   S ferredoxins                           
 164::226  1.9e-11 41.7% 0039142 00391421 1/1   S ferredoxins                           
 167::224  5.3e-11 38.2% 0046749 00467491 1/1   S ferredoxins                           
 136::238  6.4e-11 26.2% 0048346 00483461 1/1   -helical ferredoxin                     
 169::225  8.8e-11 42.6% 0035614 00356141 1/1   S ferredoxins                           
 167::224  1.1e-10 38.2% 0046170 00461701 1/1   S ferredoxins                           
 167::224  1.4e-10 38.2% 0052658 00526581 1/1   S ferredoxins                           
 167::224  1.5e-10 32.8% 0046874 00468742 2/2   S ferredoxins                           
 164::226    6e-10 36.1% 0046879 00468792 2/2   S ferredoxins                           
 167::225  6.6e-10 34.5% 0036609 00366091 1/1   S ferredoxins                           
  96::223  2.5e-09 26.2% 0038466 00384661 1/1   -helical ferredoxin                     
 165::224  3.4e-09 32.2% 0044815 00448152 2/2   S ferredoxins                           
  14::81   7.2e-08 32.8% 0045801 00458011 1/1   te reductase, domains 1 and 3           
 167::226  1.4e-07 36.7% 0043631 00436311 1/1   S ferredoxins                           
  99::154      6.5 14.3% 0046879 00468791 1/2   S ferredoxins                           
 102::155      9.3 16.7% 0046874 00468741 1/2   S ferredoxins                           
 103::155       56 13.2% 0044815 00448151 1/2   S ferredoxins                           
   1::326


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSLDINTKKLKKNAFRVTKRRGYTASRIRVPGGHLDAKLLLNIQEIADTYGDGTVHITTRQGFEIPGIDM
00351391   1/1  ----------------------------------------------------------------------
00527791   1/1  ----------------------------------------------------------------------
00384701   1/1  ----------------------------------------------------------------------
00402101   1/1  ----------------------------------------------------------------------
00520341   1/1  ----------------------------------------------------------------------
00351381   1/1  ----------------------------------------------------------------------
00450371   1/1  ----------------------------------------------------------------------
00396661   1/1  ----------------------------------------------------------------------
00471841   1/1  ----------------------------------------------------------------------
00354461   1/1  ----------------------------------------------------------------------
00471491   1/1  ----------------------------------------------------------------------
00425621   1/1  ----------------------------------------------------------------------
00440151   1/1  ----------------------------------------------------------------------
00458591   1/1  ----------------------------------------------------------------------
00533681   1/1  ----------------------------------------------------------------------
00529281   1/1  ----------------------------------------------------------------------
00491591   1/1  ----------------------------------------------------------------------
00383611   1/1  ----------------------------------------------------------------------
00477911   1/1  ----------------------------------------------------------------------
00527741   1/1  ----------------------------------------------------------------------
00394531   1/1  ----------------------------------------------------------------------
00458001   1/1  ------------------------mlrlrvpgGrltaeqlraladiaekyglngelrlTtrqnlqllgvk
00375131   1/1  ----------------------------------------------------------------------
00391421   1/1  ----------------------------------------------------------------------
00467491   1/1  ----------------------------------------------------------------------
00483461   1/1  ----------------------------------------------------------------------
00356141   1/1  ----------------------------------------------------------------------
00461701   1/1  ----------------------------------------------------------------------
00526581   1/1  ----------------------------------------------------------------------
00468742   2/2  ----------------------------------------------------------------------
00468792   2/2  ----------------------------------------------------------------------
00366091   1/1  ----------------------------------------------------------------------
00384661   1/1  ----------------------------------------------------------------------
00448152   2/2  ----------------------------------------------------------------------
00458011   1/1  -------------lGwhkqkdglfmlrlripnGrltdeqllellralaeiaekyg.gelrlTtrqnlqlh
00436311   1/1  ----------------------------------------------------------------------
00468791   1/2  ----------------------------------------------------------------------
00468741   1/2  ----------------------------------------------------------------------
00448151   1/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           KDIPEVNKKLQPIIEALEINQENPGDGYNAAGTRNVSACIGNNVCPFANYNTTNFAKKIEKAIFPNDLHF
00351391   1/1  ------------------------------dllrnviaCpgagtcglaladtrplaleledrledllylp
00527791   1/1  ----------------------------------------------------------------------
00384701   1/1  ----------------------------rlgllvdllkctgCgaCgvacpveallpggllpacgpyveag
00402101   1/1  -------------------------hlclegicggcgfcilacptgalddggsvkilidlskCigCgaCv
00520341   1/1  -----------------------------------------------------------dlspfldklla
00351381   1/1  -----------------------------Gdvvrnv.aCtglpfcglalaesidlapallerledllray
00450371   1/1  --------------------------------------------------------------llllllal
00396661   1/1  ----------------------------------------------------------------------
00471841   1/1  -------------------------------------------------------------------lll
00354461   1/1  ----------------------------------------------------------------------
00471491   1/1  ----------------------------------------------------------------------
00425621   1/1  ----------------------------------------------------------------------
00440151   1/1  --------------------------marygividlskCigcgaCevaCkdenllpvgltlalldellrp
00458591   1/1  ----------------------------------------------------------------------
00533681   1/1  ----------------------------------------------------------------------
00529281   1/1  ---------------------------------------------------------------fvillsv
00491591   1/1  ----------------------------------------------------------------------
00383611   1/1  ----------------------------qkgilidldkCigCgaCvvaCkeenil....palllarrvle
00477911   1/1  -----------------------------------------------------------------lcifc
00527741   1/1  --------------------------------------------------dseevrkarklvlelllanh
00394531   1/1  ----------------------------------------------------------------------
00458001   1/1  kedlpeilellae---------------------------------------------------------
00375131   1/1  ----------------------------------------------------------------------
00391421   1/1  ----------------------------------------------------------------------
00467491   1/1  ----------------------------------------------------------------------
00483461   1/1  -----------------------------------------------------------------lsvff
00356141   1/1  ----------------------------------------------------------------------
00461701   1/1  ----------------------------------------------------------------------
00526581   1/1  ----------------------------------------------------------------------
00468742   2/2  ----------------------------------------------------------------------
00468792   2/2  ----------------------------------------------------------------------
00366091   1/1  ----------------------------------------------------------------------
00384661   1/1  -------------------------laaglgavididkclgcgacvvacpvel......nlpvgkllgrl
00448152   2/2  ----------------------------------------------------------------------
00458011   1/1  gvpkedlpail-----------------------------------------------------------
00436311   1/1  ----------------------------------------------------------------------
00468791   1/2  ----------------------------lglvvvdedkCigcglCvlacpdaivldddglvvvllevdld
00468741   1/2  -------------------------------vvvdedkCigcglCvlvCpvgaillddgllvvlvidldl
00448151   1/2  --------------------------------lkvvvdedkCigcglCvlvCpvgaillddgllllvvdl


                         +         -         -         -         -         *         -:210
query           KIALTGCPNDCIKARMHDFGIIGMTEPQYERNRCVSCGACVRACKKKATGALSFENFKVVRDGSKCIGCG
00351391   1/1  gllprkfkiavsGcpngcaeaaiaDiglvgvakd....................................
00527791   1/1  ------cPlgalvlldngrgdislpivvidedkCigCgaCvaaCP...tgaitgdealdprgriieldgk
00384701   1/1  algetivlflpllcllcgpcvlvCptgaiagicelaellglallplgllgllgdlslgvvvidedkCigC
00402101   1/1  aaCptelll....pflpgklrgkilltlaglgaaigrvdlsdigtypkpgpviepdrCihCgdppCvkaC
00520341   1/1  icpglgpctgvcpelaeilvdperpkilidldkCigCgaCvaaCPtgaitgdflgprcllcaacllacpr
00351381   1/1  aeilldleklltedeeplyelgylprkfkiavsgcpnncarhyiaDiGlvgvakd...............
00450371   1/1  llllcgccgdcvcayacptgailgrergivvidedkCigCglCvaaCP...vgaisldglglerlvlllk
00396661   1/1  -------------------------vavidedkCigCghcedaaCvevCP...vgaitldedgllivvid
00471841   1/1  llllalcplvcplgalp...llslglvvidedkCigCglCvaaCp...vgaivlelekglvvidlekCig
00354461   1/1  --------------------------avvdldkCigCglapCvavCp...vgailledgivvidpdlCig
00471491   1/1  --------------------------ividldkCigCedglCvevCp...vgaivledglvvidpdlCig
00425621   1/1  MkvkaqygmvidldkCigCgaCvvaCkeennlpvgveylwfnnvetkPglgyprgaedleklkggwvlkf
00440151   1/1  ..........llpvkflekgvvppllalylpvlCihCedppCv.vC...PtgAiykdedgivlidpdkCi
00458591   1/1  -------------llplekldilrpvividldkCigCgaCvavCp...vgaitlvllgpracilcpacvk
00533681   1/1  --------------------------ivvdpdkCigCglapCvevCp...vgaiyledgivvidpdkCig
00529281   1/1  cigctacevacpvgai.....lkdglividaelcigcgpCvrvCPa...gaieivedggglllrvvinae
00491591   1/1  --------------------------vlidldkCigCgaCvlaC...pvgaillgdellvidpdkCigCg
00383611   1/1  llpaallplaallvlllelgvvgkvlalflpvlCvhCgdpaCvavC...Ptgaillvlkdeedgivlidp
00477911   1/1  glcvlacpllaldvtvtypleallsperfrplidldkCigCgaCvaaC...Ptgaitpdflgprglical
00527741   1/1  cldcgvCekagecelqdlavllgvlksrfvpekcrhcgpcvlvcPvgaivlvddsgglivideekCigCg
00394531   1/1  --------------------------llvvidldkCigCglCvraCp...vgaivlvellglllllllvv
00458001   1/1  ----------------------------------------------------------------------
00375131   1/1  ---------------------lgaklkldlllglvvidedkCigCgrCvraCpvgaitlvlllllrglll
00391421   1/1  -----------------------rmrvvvdedkCigCgaCvaaC...pvgaivlddglcvrvcptgdgiv
00467491   1/1  --------------------------llidldlCigcglCvkvCp...vgaillldglvvidldlCigcg
00483461   1/1  dllksikpllapdvtlappkellqspedrrklidldkCigCgaCvaaCPvyaitgdeflgprglicalrl
00356141   1/1  ----------------------------llidldkCigCgaCvlaCp...vgaillveellvidpdlCig
00461701   1/1  --------------------------llidldlCigcglCvkvCp...vgaillldglvvidldlCigcg
00526581   1/1  --------------------------llidldlCigcglCvkvCp...vgaillldglvvidldlCigcg
00468742   2/2  --------------------------vvvdedkCigcglCvlvCpvgaillddgllvvlvidldlcigcg
00468792   2/2  -----------------------lglvvvdedkCigcglCvlacp..daivldddglvvvllevdldlci
00366091   1/1  --------------------------llvdlelCigcglCvevCpvgaill....dglvlidldlcigcg
00384661   1/1  yvprievpeldpeerlkdfdevlllglgeeealrealrCihCgdppCvkvCPtgaiipeliglvyegdig
00448152   2/2  ------------------------lkvvvdedkCigcglCvlvCpvgailld.dgllllvvdldlcigcg
00458011   1/1  ----------------------------------------------------------------------
00436311   1/1  --------------------------lglvvvdedkCigcglCvlacPvgaillddggvavkltlvvded
00468791   1/2  lcigcgaCvevCPv--------------------------------------------------------
00468741   1/2  cigcglCvevCPvgA-------------------------------------------------------
00448151   1/2  dlcigcglCvevCPv-------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           ECVMNCPTNAWTRSKEKYYRLAIMGRTGKKNPRLAEDFILWVDEDSIIKIILNTYKYVTEYIAKDAPGGK
00351391   1/1  ........................gynlyvgGglg..gprlgkllgefvpeeevlevleallevyreegd
00527791   1/1  vplrfridpdkCigCgaCvevCPtgAitlvdl..lelarea-----------------------------
00384701   1/1  glCvraCPv...gaislveldpegkv--------------------------------------------
00402101   1/1  P...tgAiskdpedgiv-----------------------------------------------------
00520341   1/1  gaitleerledglvvidldrCigCgaC-------------------------------------------
00351381   1/1  .........................................gkvegfnvlvGGglgr.tprlgkrlarla
00450371   1/1  lvidlekCigCgaCve------------------------------------------------------
00396661   1/1  pdkCigCglCvevCPt------------------------------------------------------
00471841   1/1  CgaCvevCptgaitlv------------------------------------------------------
00354461   1/1  cglCvevCPvgaillellllllekc---------------------------------------------
00471491   1/1  CglCvlvCPvgaillkllllllll----------------------------------------------
00425621   1/1  dgellpalggilagll------------------------------------------------------
00440151   1/1  gCgyCvlaCPygairln-----------------------------------------------------
00458591   1/1  vcptgallklegggrvvidldkCi----------------------------------------------
00533681   1/1  CglCvavCPvga----------------------------------------------------------
00529281   1/1  nCigCgtCviaCP---------------------------------------------------------
00491591   1/1  drglepaCvevCPvgaillgdllelllelllll-------------------------------------
00383611   1/1  dlskCigCgyCvaaCPy-----------------------------------------------------
00477911   1/1  cllacprdaltkerledllvvidldrCigCgaCve-----------------------------------
00527741   1/1  rCvraCpevaitlvlglagr--------------------------------------------------
00394531   1/1  idpdlCigCgaC----------------------------------------------------------
00458001   1/1  ----------------------------------------------------------------------
00375131   1/1  lvglklvvvidlekC-------------------------------------------------------
00391421   1/1  vidpdlcigcgaCvaa------------------------------------------------------
00467491   1/1  lCvlvCPvgaille--------------------------------------------------------
00483461   1/1  ladprdaltkerledliveidldrCigC------------------------------------------
00356141   1/1  clgkgeegaCvevCP-------------------------------------------------------
00461701   1/1  lCvlvCPvgaille--------------------------------------------------------
00526581   1/1  lCvlvCPvgaille--------------------------------------------------------
00468742   2/2  lCvevCPvgAisle--------------------------------------------------------
00468792   2/2  gcgaCvevCPvgAisl------------------------------------------------------
00366091   1/1  lCvlvCPvgailled-------------------------------------------------------
00384661   1/1  ealelllstnplp---------------------------------------------------------
00448152   2/2  lCvevCPvgAisle--------------------------------------------------------
00458011   1/1  ----------------------------------------------------------------------
00436311   1/1  lcigcgaCvevCPvgA------------------------------------------------------
00468791   1/2  ----------------------------------------------------------------------
00468741   1/2  ----------------------------------------------------------------------
00448151   1/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           EHIGYIIDRTGFMEFKKWALEGVTLSEKALMKNNVYWSGIHYTNGF------------------------
00351391   1/1  r.....gerlgdlvdrlGlekfrev---------------------------------------------
00527791   1/1  ----------------------------------------------------------------------
00384701   1/1  ----------------------------------------------------------------------
00402101   1/1  ----------------------------------------------------------------------
00520341   1/1  ----------------------------------------------------------------------
00351381   1/1  kllglvpaeevldvleailevyrdl.gdrgnrkkerfkylvd----------------------------
00450371   1/1  ----------------------------------------------------------------------
00396661   1/1  ----------------------------------------------------------------------
00471841   1/1  ----------------------------------------------------------------------
00354461   1/1  ----------------------------------------------------------------------
00471491   1/1  ----------------------------------------------------------------------
00425621   1/1  ----------------------------------------------------------------------
00440151   1/1  ----------------------------------------------------------------------
00458591   1/1  ----------------------------------------------------------------------
00533681   1/1  ----------------------------------------------------------------------
00529281   1/1  ----------------------------------------------------------------------
00491591   1/1  ----------------------------------------------------------------------
00383611   1/1  ----------------------------------------------------------------------
00477911   1/1  ----------------------------------------------------------------------
00527741   1/1  ----------------------------------------------------------------------
00394531   1/1  ----------------------------------------------------------------------
00458001   1/1  ----------------------------------------------------------------------
00375131   1/1  ----------------------------------------------------------------------
00391421   1/1  ----------------------------------------------------------------------
00467491   1/1  ----------------------------------------------------------------------
00483461   1/1  ----------------------------------------------------------------------
00356141   1/1  ----------------------------------------------------------------------
00461701   1/1  ----------------------------------------------------------------------
00526581   1/1  ----------------------------------------------------------------------
00468742   2/2  ----------------------------------------------------------------------
00468792   2/2  ----------------------------------------------------------------------
00366091   1/1  ----------------------------------------------------------------------
00384661   1/1  ----------------------------------------------------------------------
00448152   2/2  ----------------------------------------------------------------------
00458011   1/1  ----------------------------------------------------------------------
00436311   1/1  ----------------------------------------------------------------------
00468791   1/2  ----------------------------------------------------------------------
00468741   1/2  ----------------------------------------------------------------------
00448151   1/2  ----------------------------------------------------------------------