[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cper0:BAB81145.1


[Show Plain Result]

## Summary of Sequence Search
   1::263
  89::260  1.7e-32 35.3% 0046601 00466011 1/1   doxin reductase-like, C-terminal NADP-l 
  83::224  6.7e-31 29.1% 0047323 00473231 1/1   doxin reductase-like, C-terminal NADP-l 
  82::224    2e-28 33.3% 0041322 00413221 1/1   doxin reductase-like, C-terminal NADP-l 
  95::242  1.1e-26 29.7% 0035107 00351071 1/1   doxin reductase-like, C-terminal NADP-l 
  89::225  3.3e-26 30.1% 0052188 00521881 1/1   doxin reductase-like, C-terminal NADP-l 
  94::242  7.8e-26 28.3% 0037677 00376771 1/1   doxin reductase-like, C-terminal NADP-l 
  94::234  8.5e-26 30.4% 0049711 00497111 1/1   doxin reductase-like, C-terminal NADP-l 
  94::242  1.8e-25 25.3% 0036370 00363701 1/1   doxin reductase-like, C-terminal NADP-l 
  99::242  3.2e-25 27.9% 0042754 00427541 1/1   doxin reductase-like, C-terminal NADP-l 
  84::224  1.6e-24 28.6% 0049950 00499501 1/1   doxin reductase-like, C-terminal NADP-l 
  95::240  3.1e-24 27.7% 0034955 00349551 1/1   doxin reductase-like, C-terminal NADP-l 
  96::245  5.2e-24 27.6% 0052011 00520111 1/1   doxin reductase-like, C-terminal NADP-l 
  97::235  1.2e-22 32.1% 0036119 00361191 1/1   doxin reductase-like, C-terminal NADP-l 
  99::242  1.8e-22 30.0% 0043660 00436601 1/1   doxin reductase-like, C-terminal NADP-l 
  94::242  2.5e-22 26.6% 0038028 00380281 1/1   doxin reductase-like, C-terminal NADP-l 
  99::245  5.5e-22 25.4% 0039466 00394661 1/1   doxin reductase-like, C-terminal NADP-l 
  97::223  1.9e-21 27.2% 0048943 00489431 1/1   doxin reductase-like, C-terminal NADP-l 
  93::224  1.7e-20 26.7% 0053272 00532721 1/1   doxin reductase-like, C-terminal NADP-l 
  96::234  2.2e-20 25.9% 0038292 00382921 1/1   doxin reductase-like, C-terminal NADP-l 
  97::231    7e-20 33.1% 0040222 00402221 1/1   doxin reductase-like, C-terminal NADP-l 
  96::223    1e-19 28.3% 0037504 00375041 1/1   doxin reductase-like, C-terminal NADP-l 
  93::242  1.2e-17 24.0% 0046686 00466861 1/1   doxin reductase-like, C-terminal NADP-l 
   4::94   1.3e-17 27.5% 0046600 00466001 1/1   lavin synthase domain-like              
   5::94   1.9e-11 34.4% 0040221 00402211 1/1   lavin synthase domain-like              
   5::94   2.2e-10 32.2% 0034954 00349541 1/1   lavin synthase domain-like              
   3::98   2.3e-10 30.2% 0038912 00389121 1/1   lavin synthase domain-like              
   3::98   5.2e-10 31.2% 0041321 00413211 1/1   lavin synthase domain-like              
   6::95     3e-09 28.9% 0042742 00427421 1/1   lavin synthase domain-like              
   1::92   1.1e-08 30.4% 0049710 00497101 1/1   lavin synthase domain-like              
   6::98   1.1e-08 23.7% 0045224 00452241 1/1   lavin synthase domain-like              
  11::98   3.6e-08 34.1% 0049949 00499491 1/1   lavin synthase domain-like              
   1::98   1.3e-07 23.5% 0047554 00475541 1/1   lavin synthase domain-like              
   7::98   5.1e-06 23.9% 0048947 00489471 1/1   lavin synthase domain-like              
   4::95   7.8e-06 27.2% 0036118 00361181 1/1   lavin synthase domain-like              
   2::94   1.1e-05 26.4% 0038291 00382911 1/1   lavin synthase domain-like              
   1::94   3.2e-05 22.0% 0038027 00380271 1/1   lavin synthase domain-like              
   2::94   4.2e-05 22.0% 0046758 00467581 1/1   lavin synthase domain-like              
   8::95   0.00079 22.7% 0052010 00520101 1/1   lavin synthase domain-like              
   1::263


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MHNEYTPFISKILNVKKHTDIEYTFRMEFKGDVKPGQFFEVSLPKFGEAPISVSGIGEDYVELTIRRVGV
00466011   1/1  ----------------------------------------------------------------------
00473231   1/1  ----------------------------------------------------------------------
00413221   1/1  ----------------------------------------------------------------------
00351071   1/1  ----------------------------------------------------------------------
00521881   1/1  ----------------------------------------------------------------------
00376771   1/1  ----------------------------------------------------------------------
00497111   1/1  ----------------------------------------------------------------------
00363701   1/1  ----------------------------------------------------------------------
00427541   1/1  ----------------------------------------------------------------------
00499501   1/1  ----------------------------------------------------------------------
00349551   1/1  ----------------------------------------------------------------------
00520111   1/1  ----------------------------------------------------------------------
00361191   1/1  ----------------------------------------------------------------------
00436601   1/1  ----------------------------------------------------------------------
00380281   1/1  ----------------------------------------------------------------------
00394661   1/1  ----------------------------------------------------------------------
00489431   1/1  ----------------------------------------------------------------------
00532721   1/1  ----------------------------------------------------------------------
00382921   1/1  ----------------------------------------------------------------------
00402221   1/1  ----------------------------------------------------------------------
00375041   1/1  ----------------------------------------------------------------------
00466861   1/1  ----------------------------------------------------------------------
00466001   1/1  ---llllllltvvevreltpdvvllvlelpdlalaflpGqfvtlrvpgggellrrpysiasapsedgtle
00402211   1/1  ----lklleltvvsverltddvlslrlelpdgaallgflpGqyvllrlpglgllRpYSlasapgegllel
00349541   1/1  ----lklleltvvevelltddvfslrlelpdglgflpGqfvllrlpidgelllRaYSiasapdegelell
00389121   1/1  --lplkflplkvveverltpdvklfrlelpdgeqllgllpGqhvllrlpidgelvvRaYtpasapdekgy
00413211   1/1  --lplkflelkvvsverltpdvklfrlelpdgadllgllpGqhvllrlpidgelvvRpYspasapdekgy
00427421   1/1  -----kllearvvsvelltddvlslrlelpdgfsfkpGqyvllrldgllrrpySiasapdedgllelhvr
00497101   1/1  llllllplkflelrvvsverltddvvslrlelpdgealelllgflpGqyvtlrlpglgllRpYSlasapd
00452241   1/1  -----kflelkvvskeelshdikllrlelpdgllllgflpGqhvllrvpidgelvlRsYslaslpdekgl
00499491   1/1  ----------rvvevellthdvksfrlelpdgllllgflpgqhvtlrlpidgelvvRsYspasapddkgy
00475541   1/1  lygpknpfeatvlsnrrltgpgsspdtrhlvldlpggldylpGqylgvlppnddalvelpplqpRlYSia
00489471   1/1  ------pltatvvenrrltgedsskdvrhleldlpdgldylpGqylgvlppnddelvppllpRlYSiass
00361181   1/1  ---plgllelrvvsverltddivslvlelpdgaelldflpGqyvllllpigglellllRsYSlasapsdg
00382911   1/1  -llplgflelrvvsvelltddivslvlelpdgaallgflpGqyillrlpigglellvlRsYSlasapdd.
00380271   1/1  lrlscqvvvkedlalevplnlysvknpllatvvsnrrltgedvardvrhlvldlpgglsylpGdylgilp
00467581   1/1  -lgfleltvveverltddv.vslrlelp.llgflaGqyvtlrlpidgelvlRaYSlasapddgllellvk
00520101   1/1  -------lenrvltkenssrdvrhleldlpgsgldylpGqylgilppnddelvppllpRaYSiasspled


                         -         -         *         -         -         -         -:140
query           VTNEIFEKYEGDKLFLRGPYGNGFDVNNYKGKEVIVVAGGTGLSPVKGIVDYFSQNPKDAESFTLISGFK
00466011   1/1  ------------------Plgnff.....pakpllliAgGtGitPllsmlrallalga...kvtliygar
00473231   1/1  ------------tlevrgPlgd.ftldedsakpllliAgGtGitPllsmlrallargedlrkvtllygar
00413221   1/1  -----------DtlevrgPlgdfflle..sgkpllliAgGtGitPllsilrallengedlrkvtllygar
00351071   1/1  ------------------------flppdpgkpliliagGtGiaPflsilrellalgedglklgkvvlfy
00521881   1/1  ------------------PlGn.fflredsakpllliAgGtGitPllsilrallargpedlrkvtllyga
00376771   1/1  -----------------------FllpedpgkpliliagGtGiaPfrsilrellargadlglklgkvvLf
00497111   1/1  -----------------------FfllldsakpllliAgGtGitPllsmlrallal.gdkrkvtllygar
00363701   1/1  -----------------------lpldp..drpliliagGtGiAPfrsflqellal.galgkvllffgar
00427541   1/1  ----------------------------dpgkpliliagGtGiaPfrsilrellalglenpedlgkvvlf
00499501   1/1  -------------gvevrgPlGdfflrp.dsakpllliAgGtGitPllsmlrallangsdlrkvtllyga
00349551   1/1  ------------------------llpldpgkpllliagGtGiaPflsilrellal.gdfgkvtlvygar
00520111   1/1  -------------------------lppdpakpllliAgGtGiaPflsmlrellalgadglllkllllgk
00361191   1/1  --------------------------pvdsakplvliagGtGitPllsilrallarg..lrkvtliygar
00436601   1/1  ----------------------------dpgkpliliagGtGiaPfrsflrellalgpenpedlgkvtlf
00380281   1/1  -----------------------lppdp..gkpliliagGtGiaPfrsilrellalgadgtlklgkvvLf
00394661   1/1  ----------------------------dpgkpliliAgGtGiAPflsflrellalgadlllklgkvvLf
00489431   1/1  --------------------------ledsdrpllliAgGtGiaPllsilrallarg.dkrpvtllygar
00532721   1/1  ----------------------dFvlde.sakpvlliAgGiGitPllsmlrallarg..lrdvtllygar
00382921   1/1  -------------------------llldsarpllliAgGtGitPllsmlrallargad.rpvtllygar
00402221   1/1  --------------------------pldpakpllliagGtGiaPflsilrallalg.dlrkvtliygar
00375041   1/1  -------------------------lpldpgkpllllAgGtGiaPflsilrall.dledfgkvvLvygar
00466861   1/1  ----------------------sFllpedpdkpliliagGtGiAPfrsflqerlalgaelglklgpvvlf
00466001   1/1  llvkvvpgGlgtrlladlkvGdll----------------------------------------------
00402211   1/1  lvkrvpgGlvsnylhdelkvGdtl----------------------------------------------
00349541   1/1  vkrvpgGlvssylhdlkvGdtllv----------------------------------------------
00389121   1/1  lellvkrvlkslgllllpgGkvsnyLhd------------------------------------------
00413211   1/1  lellvkrvldsldllflpgGkvsnyLhd------------------------------------------
00427421   1/1  avpgglvtsllldalkvgdtllvsg---------------------------------------------
00497101   1/1  ddgllellvkrvpgGlvsnylh------------------------------------------------
00452241   1/1  lellvkvylkslglkllpgGlvssyLhs------------------------------------------
00499491   1/1  lellvkrvapsedlllppgGkvSnyLhd------------------------------------------
00475541   1/1  sspllddddpgtleltvkvvtyetdeld------------------------------------------
00489471   1/1  plgdlaepgeisltvkvvryptplgrir------------------------------------------
00361181   1/1  llellvkrvpgsrgglGlvSnylhd---------------------------------------------
00382911   1/1  .grleilvkrvpgGlvsnwlhdel----------------------------------------------
00380271   1/1  pnsdelvkplkpRlYSiassplgd----------------------------------------------
00467581   1/1  rvpgGlvsnylhdlkpGdtlevlg----------------------------------------------
00520101   1/1  kvvpgeisltvkvveyktpllgrlr---------------------------------------------


                         +         -         -         -         -         *         -:210
query           GPKDILFKDDMKEWEKNMNMIITVDSAEEGYEGNTGLVTKYIPELEIKDMDNVQVIVVGPPMMMKFTVLE
00466011   1/1  seedllfldeleela.nlrvvlvls...dewtglkgrvtdlllellpd.gd..lvyvCGppgmmdavrea
00473231   1/1  seedllfrdeleelaarhpdnlrvvlvlsreddgwlglvgrvtealleallpllledtlvylCGpppmmk
00413221   1/1  teedllfrdeleelakrlpdnlrlhlvlsreddgwlglqgrvtelllaellpldledalvylCGppgmmk
00351071   1/1  gartedldllyrdeleelakegpllrlvlalsreqegwvyvqgrltelllellllldlegahvyvCGppg
00521881   1/1  rteddllfrdeleelaarypdnlrvvlvlsrellpddgwkglvgrvtaalleellpllledtlvylCGPp
00376771   1/1  ygarteddllyrdeleelakegpdllrlvlalsreqegwkglkgyvqdlllelalellelldpedalvyv
00497111   1/1  seddllfldelealaaelpnlrlvlvlsreddgwlgvqgrvteallelllldledalvyvCGpppmmkav
00363701   1/1  npeldllyrdeleelakagpllrlvlalsreqggkvyvqgrltellaellelldegahvyvCGppkgmvk
00427541   1/1  fgarteddllyreeleelakegpdllrlvlalsreqddwkglkgyvqdlllelaelllllldlegalvyv
00499501   1/1  rteedilfrdeleelaarlpnlllvvvvlsrededwlggvgrvteelllelllldledtlvylCGPppmm
00349551   1/1  teddllyrdeleelakrypllgellkdnlklvlvlsredegwkgyvqdlllegrvtaalllelldp.eda
00520111   1/1  vtlfygarseddllyrdeleelakrgpdnlrlvlalsreqegwtglkgyvqdlllelllelldlldlega
00361191   1/1  seddllfrdeleelaaelpnlrlhlvlsrepeedtldgwlgvqgrvteallell.ldlegalvyvCGPpp
00436601   1/1  fgarteedllyrdeleelakegpdllrlvlalsreqddwkglkgyvqdlllelldlllllldpegalvyv
00380281   1/1  ygarteddllyrdeleelakegpdllrlvlalsreqddweglkgyvqdllleealellelldlegalvyv
00394661   1/1  ygarsrddllyreeleelakegpdlfrlvlalsreqdgwkglkgyvqdllledllellelldegahvyvC
00489431   1/1  seedllfrdelealaarhpnlrvvlvlsrpddgwtgltgrvteallell.ldledadvylCGpppmvdav
00532721   1/1  spddllfldelealaarlplrvhlvls...seggrgrvtdllle....lledalvyvCGPppmmdavrea
00382921   1/1  seddllfldeleelaarlpnlrlvlvlsrpdeddlyvqwtgregrvtaalllellpd.edadvylCGPpg
00402221   1/1  seddllfrdeleelaaelpnlrlvlvlsr.edgwlglkgrvtdlllell.ldlegalvyvCGppgmmkav
00375041   1/1  teedllyldeleelakrypdnlkvvlvlsrepdwdglkgrvtdlllegllaellglpldledtlvylCGp
00466861   1/1  fgcrnrdldllyrdeleellkegpllrlvvafsreqdgekgyvqdlllelleelldlllllegahvyvCG
00466001   1/1  ----------------------------------------------------------------------
00402211   1/1  ----------------------------------------------------------------------
00349541   1/1  ----------------------------------------------------------------------
00389121   1/1  ----------------------------------------------------------------------
00413211   1/1  ----------------------------------------------------------------------
00427421   1/1  ----------------------------------------------------------------------
00497101   1/1  ----------------------------------------------------------------------
00452241   1/1  ----------------------------------------------------------------------
00499491   1/1  ----------------------------------------------------------------------
00475541   1/1  ----------------------------------------------------------------------
00489471   1/1  ----------------------------------------------------------------------
00361181   1/1  ----------------------------------------------------------------------
00382911   1/1  ----------------------------------------------------------------------
00380271   1/1  ----------------------------------------------------------------------
00467581   1/1  ----------------------------------------------------------------------
00520101   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           FLKRGIKEENIWISQERKMCCGLGKCGHCKIDDTYICLDGPVFNYTKGKLLID-----------------
00466011   1/1  llelg....kerihlErfmacgvgacgacvvkvkggelslllvcvdgpvf--------------------
00473231   1/1  avlreallelgvpe--------------------------------------------------------
00413221   1/1  avvreallelgvpe--------------------------------------------------------
00351071   1/1  gmvkavreallelgvpegnihlelfgpylcrl--------------------------------------
00521881   1/1  pmmkavlrelllelg-------------------------------------------------------
00376771   1/1  CGppgmakdvreaLlelgvpeerialelfgsl--------------------------------------
00497111   1/1  reallelgvpeerih..lErfgac----------------------------------------------
00363701   1/1  avreallelgvpagrihlelflpylcrlgkcg--------------------------------------
00427541   1/1  CGppgmakdvkeaLlelgvpeerialelfgsl--------------------------------------
00499501   1/1  davrelllelgvpe--------------------------------------------------------
00349551   1/1  lvyvCGppgmvkavkeallelgvpeeri..----------------------------------------
00520111   1/1  hvyvCGpppmmdavraallelgvpegrihfElfgs-----------------------------------
00361191   1/1  mmkavreallelgvpeerih..lEr---------------------------------------------
00436601   1/1  CGppgmakdvreaLlelgvpeenialelfgkl--------------------------------------
00380281   1/1  CGppgmvkdvreaLlelgvpeerialelfgsl--------------------------------------
00394661   1/1  Gppgmvkavreallelgvpegrihle....lfasl-----------------------------------
00489431   1/1  realllelgvpee---------------------------------------------------------
00532721   1/1  l..lgvpaerihfE--------------------------------------------------------
00382921   1/1  mmdavreallelgvpeerih..lE----------------------------------------------
00402221   1/1  reallelgvpeerih..lErf-------------------------------------------------
00375041   1/1  pgmveavlealle---------------------------------------------------------
00466861   1/1  ppgmvkdvreallelgveegrihaeafgeylk--------------------------------------
00466001   1/1  ----------------------------------------------------------------------
00402211   1/1  ----------------------------------------------------------------------
00349541   1/1  ----------------------------------------------------------------------
00389121   1/1  ----------------------------------------------------------------------
00413211   1/1  ----------------------------------------------------------------------
00427421   1/1  ----------------------------------------------------------------------
00497101   1/1  ----------------------------------------------------------------------
00452241   1/1  ----------------------------------------------------------------------
00499491   1/1  ----------------------------------------------------------------------
00475541   1/1  ----------------------------------------------------------------------
00489471   1/1  ----------------------------------------------------------------------
00361181   1/1  ----------------------------------------------------------------------
00382911   1/1  ----------------------------------------------------------------------
00380271   1/1  ----------------------------------------------------------------------
00467581   1/1  ----------------------------------------------------------------------
00520101   1/1  ----------------------------------------------------------------------