[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cper0:BAB81146.1


[Show Plain Result]

## Summary of Sequence Search
   1::338
 173::335  3.4e-14 20.3% 0052034 00520341 1/1   -helical ferredoxin                     
 174::336  7.2e-12 22.0% 0048346 00483461 1/1   -helical ferredoxin                     
 221::333  9.8e-12 26.1% 0047791 00477911 1/1   -helical ferredoxin                     
 203::318  3.3e-08 23.1% 0045859 00458591 1/1   S ferredoxins                           
 215::336  2.3e-07 24.4% 0052779 00527791 1/1   S ferredoxins                           
 220::318  5.5e-07 22.7% 0040210 00402101 1/1   S ferredoxins                           
 220::317  5.9e-06 25.9% 0039453 00394531 1/1   S ferredoxins                           
 221::315    7e-06 26.3% 0037513 00375131 1/1   S ferredoxins                           
 221::316  3.2e-05 37.8% 0038470 00384701 1/1   S ferredoxins                           
 215::323  5.9e-05 31.0% 0039666 00396661 1/1   S ferredoxins                           
 216::315  6.5e-05 33.3% 0035446 00354461 1/1   S ferredoxins                           
 213::315  0.00017 26.9% 0039142 00391421 1/1   S ferredoxins                           
 216::316  0.00022 32.7% 0053368 00533681 1/1   S ferredoxins                           
 216::322  0.00031 30.9% 0046749 00467491 1/1   S ferredoxins                           
 221::315  0.00036 34.1% 0045037 00450371 1/1   S ferredoxins                           
 216::322  0.00043 30.9% 0046170 00461701 1/1   S ferredoxins                           
 216::322  0.00056 30.9% 0052658 00526581 1/1   S ferredoxins                           
 294::322     0.03 27.6% 0046879 00468792 2/2   S ferredoxins                           
 213::247     0.95 24.2% 0046879 00468791 1/2   S ferredoxins                           
   1::338


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGLRLTKDNFDKIIDCLKKEYKIYAPKVMEGKGRFSDTDMTRYGEIDSINDIEFSKKSDFSYKEVLLPIT
00520341   1/1  ----------------------------------------------------------------------
00483461   1/1  ----------------------------------------------------------------------
00477911   1/1  ----------------------------------------------------------------------
00458591   1/1  ----------------------------------------------------------------------
00527791   1/1  ----------------------------------------------------------------------
00402101   1/1  ----------------------------------------------------------------------
00394531   1/1  ----------------------------------------------------------------------
00375131   1/1  ----------------------------------------------------------------------
00384701   1/1  ----------------------------------------------------------------------
00396661   1/1  ----------------------------------------------------------------------
00354461   1/1  ----------------------------------------------------------------------
00391421   1/1  ----------------------------------------------------------------------
00533681   1/1  ----------------------------------------------------------------------
00467491   1/1  ----------------------------------------------------------------------
00450371   1/1  ----------------------------------------------------------------------
00461701   1/1  ----------------------------------------------------------------------
00526581   1/1  ----------------------------------------------------------------------
00468792   2/2  ----------------------------------------------------------------------
00468791   1/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           QTLFFFTEDKFSEASVEEKNILIFLRSCDMHSLRRIDDIYLRNGFEDPYYKKLREKAKFIVMGCENSFDN
00520341   1/1  ----------------------------------------------------------------------
00483461   1/1  ----------------------------------------------------------------------
00477911   1/1  ----------------------------------------------------------------------
00458591   1/1  ----------------------------------------------------------------------
00527791   1/1  ----------------------------------------------------------------------
00402101   1/1  ----------------------------------------------------------------------
00394531   1/1  ----------------------------------------------------------------------
00375131   1/1  ----------------------------------------------------------------------
00384701   1/1  ----------------------------------------------------------------------
00396661   1/1  ----------------------------------------------------------------------
00354461   1/1  ----------------------------------------------------------------------
00391421   1/1  ----------------------------------------------------------------------
00533681   1/1  ----------------------------------------------------------------------
00467491   1/1  ----------------------------------------------------------------------
00450371   1/1  ----------------------------------------------------------------------
00461701   1/1  ----------------------------------------------------------------------
00526581   1/1  ----------------------------------------------------------------------
00468792   2/2  ----------------------------------------------------------------------
00468791   1/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           CFCVSMGTNKTDEYSAYIGLDNDEVLLDIKDEELSKIFEAVESNKEEVSPKFVEENETKVEVPEGIDLNI
00520341   1/1  --------------------------------dlspfldkllaicpglg......pctgvcpelaeilvd
00483461   1/1  ---------------------------------lsvffdllksikpllapdvtlapp.kellqspedrrk
00477911   1/1  ----------------------------------------------------------------------
00458591   1/1  --------------------------------------------------------------llplekld
00527791   1/1  ----------------------------------------------------------------------
00402101   1/1  ----------------------------------------------------------------------
00394531   1/1  ----------------------------------------------------------------------
00375131   1/1  ----------------------------------------------------------------------
00384701   1/1  ----------------------------------------------------------------------
00396661   1/1  ----------------------------------------------------------------------
00354461   1/1  ----------------------------------------------------------------------
00391421   1/1  ----------------------------------------------------------------------
00533681   1/1  ----------------------------------------------------------------------
00467491   1/1  ----------------------------------------------------------------------
00450371   1/1  ----------------------------------------------------------------------
00461701   1/1  ----------------------------------------------------------------------
00526581   1/1  ----------------------------------------------------------------------
00468792   2/2  ----------------------------------------------------------------------
00468791   1/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           IKSTVWNEYSERCIACGRCNFVCPTCTCFTMQDVFYKDNENAGERRRVWASCQVDGYTDMAGGHSFRKDK
00520341   1/1  perpkilidldkCigCgaCvaaCPtgaitgd.........flgprcllcaacllacprga..........
00483461   1/1  lidl......dkCigCgaCvaaCPvyaitgde........flgprglicalrlladprdal.........
00477911   1/1  ----------dkCigCgaCvaaCPtgaitpd.........flgprglicalcllacprda..........
00458591   1/1  ilrpvividldkCigCgaCvavCpvgai...tlvllgpracilc.pacvkvcptgallklegggrvv...
00527791   1/1  ----cPlgalvlldngrgdislpivvidedkCigCgaCvaaCPt.gaitgdealdprgri..........
00402101   1/1  ---------hlclegicggcgfcilacptgalddggsvkilidlskCigCgaCvaaCptelll.......
00394531   1/1  ---------llvvidldkCigCglCvraCpvgaivlvell..............................
00375131   1/1  ----------lgaklkldlllglvvidedkCigCgrCvraCpvgaitlvlllllr...............
00384701   1/1  ----------dkCigCglCvraCPv.......gaislveldpeg..........................
00396661   1/1  ----vavidedkCigCghcedaaCvevCPv........................................
00354461   1/1  -----avvdldkCigCglapCvavCpv...........................................
00391421   1/1  --rmrvvvdedkCigCgaCvaaCpvg............................................
00533681   1/1  -----ivvdpdkCigCglapCvevCpv.......gaiyledg............................
00467491   1/1  -----llidldlCigcglCvkvCpvgailll.......................................
00450371   1/1  ----------dkCigCglCvaaCPv.............................................
00461701   1/1  -----llidldlCigcglCvkvCpvgailll.......................................
00526581   1/1  -----llidldlCigcglCvkvCpvgailll.......................................
00468792   2/2  ----------------------------------------------------------------------
00468791   1/2  --lglvvvdedkCigcglCvlacp..daivldddglv---------------------------------


                         -         *         -         -         -         -         +:350
query           GQRMRFKVMHKVYDYKKRWGYHMCVGCGRCDDICPEYISFSECVNKLKDAVEEVKDNA------------
00520341   1/1  .....itleerledglvvidldrCigCgaCvevCPvgailvdlirelrrllveeg---------------
00483461   1/1  .......tkerledliveidldrCigCgaCvevCPvgiilvdliaelrrllvkrgl--------------
00477911   1/1  ......ltkerledllvvidldrCigCgaCvevCPvgailvdlirelrrelve-----------------
00458591   1/1  ..................idldkCigCglCvevCPvga--------------------------------
00527791   1/1  .........................ieldgkvplrfridpdkCigCgaCvevCPtg--------------
00402101   1/1  ...pflpgklrgkilltlaglgaaigrvdlsdi.gtyp--------------------------------
00394531   1/1  ..............glllllllvvidpdlCigCgaCv---------------------------------
00375131   1/1  .......................gllllvglklvv-----------------------------------
00384701   1/1  ..................kvvidpdkCtgCglCvev----------------------------------
00396661   1/1  ...........gaitldedgllivvidpdkCigCglCvevCPt---------------------------
00354461   1/1  ........gaill.edgivvidpdlCigcglCvev-----------------------------------
00391421   1/1  .......aivlddglcvrvcptgdgivvidpdlci-----------------------------------
00533681   1/1  .................ivvidpdkCigCglCvavC----------------------------------
00467491   1/1  .............dglvvidldlCigcglCvlvCPvgaille----------------------------
00450371   1/1  ......gaisldglglerlvlllklvidlekCigC-----------------------------------
00461701   1/1  .............dglvvidldlCigcglCvlvCPvgaille----------------------------
00526581   1/1  .............dglvvidldlCigcglCvlvCPvgaille----------------------------
00468792   2/2  -------------lglvvvdedkCigcglCvlacpdaivldd----------------------------
00468791   1/2  ----------------------------------------------------------------------