[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cper0:BAB81193.1


[Show Plain Result]

## Summary of Sequence Search
   1::334
  37::270  6.6e-25 25.2% 0051090 00510901 1/1   lasmic binding protein-like II          
  35::274  1.3e-20 24.3% 0049987 00499871 1/1   lasmic binding protein-like II          
  40::331  3.4e-20 20.5% 0052357 00523571 1/1   lasmic binding protein-like II          
  71::304  4.1e-15 25.2% 0051539 00515391 1/1   lasmic binding protein-like II          
  40::212  1.1e-10 23.4% 0046857 00468571 1/1   lasmic binding protein-like II          
  42::274  8.2e-09 24.3% 0042201 00422011 1/1   lasmic binding protein-like II          
  36::225  1.5e-06 24.2% 0038704 00387041 1/1   lasmic binding protein-like II          
  40::225  1.7e-06 25.0% 0050446 00504461 1/1   lasmic binding protein-like II          
  36::225    3e-06 25.8% 0040650 00406501 1/1   lasmic binding protein-like II          
  33::267  8.5e-06 21.4% 0051099 00510991 1/1   lasmic binding protein-like II          
  35::184  0.00031 20.7% 0046370 00463701 1/1   lasmic binding protein-like II          
  32::275  0.00048 16.5% 0043183 00431831 1/1   lasmic binding protein-like II          
  57::165  0.00053 24.8% 0046118 00461181 1/1   lasmic binding protein-like II          
  58::165  0.00063 26.0% 0046371 00463711 1/1   lasmic binding protein-like II          
   1::334


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKKLNKFLSLVLMVLFSLSILVGCNTSKKEEAKAPEEKTSIEIVVPDGLPAISIVKMIKEKPEIMKGLDI
00510901   1/1  ------------------------------------ekktlrigylpgpdaapl.elakglfkk.lGldv
00499871   1/1  ----------------------------------ppktlrigtgspggtyyplgvalakglfkellglkv
00523571   1/1  ---------------------------------------tlrlgwspylndlplfvalekglfke.gldv
00515391   1/1  ----------------------------------------------------------------------
00468571   1/1  ---------------------------------------gtlrvgvdlslpyvmllepfsyldgngkltG
00422011   1/1  -----------------------------------------tikvgatpphaeilevikkllkkk.Gidv
00387041   1/1  -----------------------------------kergtlrvgvdpdypPfsyldedgklvGfdvdlak
00504461   1/1  ---------------------------------------tLrvgvdpdypPfsflddgklvGfdvdlaka
00406501   1/1  -----------------------------------kergtLrvgtdpdypPfsyldedgelvGfdvdlak
00510991   1/1  --------------------------------LlslaaiaaagtlrvgvspdypPfsyldedgkltGfdv
00463701   1/1  ----------------------------------lvapktlrwcvvsveelkkcqpladalsk..lgppv
00431831   1/1  -------------------------------lalagdgktvrigyvnwtsatattavaklllek.lGykv
00461181   1/1  --------------------------------------------------------llllllapdktvrw
00463711   1/1  ---------------------------------------------------------rlalapdestvrw


                         -         -         *         -         -         -         -:140
query           NYSIVKGSDALVSKVLKGEGDICIVPSNVAAIAYNKEAKYKLAGTVGFGSLYVISSDDSVNSLEDLKGKD
00510901   1/1  elveftdgaallealasGelDvalfgslpyllayakglpvklvavlstygsalvvrdsgikslaDLkdGk
00499871   1/1  evvptggsvanlealaaGevDlalvgsdpallaqagtgpfegkgapldnlravaalypeplalvvrkdsg
00523571   1/1  eiv.fadpatlnellaagelDvavissaayllaadkyaplpavaalgpgnsvlvvskkp...ledlkGkr
00515391   1/1  tlrvGhspypndlplfyalaeglvdlgllfeivledpetlnelllsgeldvaaissalyalladdyvllp
00468571   1/1  fdvdllralakrl....glkvelvpvpdglygglnlengswdgllgalqsGeaDlaa..ggltitperek
00422011   1/1  eivefsdysapneaLasGeiDanafqhlpyldafnkenaglklvavgatyiaplglyskk..iksledLk
00387041   1/1  alakrl.gvkvefvpv.swdgllpalasgkvDlaiag...ltitperakvvdfsapyyvsglvlvvrkds
00504461   1/1  iakrl.glkvefvpv.dwdgllpalqsgkvDlaiag...ltitperekvvdfsdpyyssglvlvvrkdns
00406501   1/1  aiakrl.gvkvefvpv.dwdrllpalqsgkvDliiag...ltitperekvvdfsdpyytsglvlvvrkds
00510991   1/1  dlakalakrllgdpvkvefvpv.pwdrllealasgkvDlaiag...ltitperekgvdfsdpyytsglvl
00463701   1/1  ecvvatdyldcieairngeaDaatldggdvylagkkgyglvpvvaevygdgsgaetsyyavavVkkdsgi
00431831   1/1  eltvfldyvvlyealanGdiDvgleawlpltdelyakavgdgkvvalganlegakqglavpkyvadkpgi
00461181   1/1  CvvsdaellkCdalskalgvevecvvatdyadciealrngeaDlatldpgsyylAgkyglvpvlaevydd
00463711   1/1  CvvsdaellkcdylsealgvevecvvatdyaeciealrngeaDlatlgpgsyylagkyglepvaaevydd


                         +         -         -         -         -         *         -:210
query           VYNVGQGLTPDLIFKILLQNDGINPEKDLTLSYVNAASELAPLFIEGKAKYAVVPEPMLTQIMTKKPETK
00510901   1/1  kvavpnggstsglll.allkkaGlikldplkdvklvnld.padavaalasgevDaavlweplddvdlavi
00499871   1/1  ikslaDLkGKrvavgapGsgtellllalleaaGltp.ddvelvvnlg.padaaaaladgkvDAavtvdpl
00523571   1/1  iavpggsttsalllrlllk........dvelvyv.pfdeiiaallrgevdaglligdsaltaaer..glv
00515391   1/1  vgailgrgygpsvvlksgvp....lkgkkialpgrsttaalLlrlllp........daglvevpf.peip
00468571   1/1  vvdfsapylesglvllvrkdspllspiksledLkgkdglkvgvvrgssteeyllelllelglllldkmip
00422011   1/1  dgkkiAipndpsnegralll.Lqkagliklkpgagllatvkdivenpkdlkiveldaaqlpral...gdv
00387041   1/1  pliksladLkgkrvgvv.kgstyelllkkllkkpgl......kivdyddpaealaaLaaGrvDaavadep
00504461   1/1  giksledLkgkrvgvvrgssteellkkll.........pdaklvlvdsleealaallsgrvdavvadspv
00406501   1/1  pliksledLkgkrvgvv.kgttyelllkkllkkpgl......kivlvddlaealqaLlaGrvDaavadsp
00510991   1/1  vvrkdspiksladLkgkrvgvvrgssyeelllell.........pdvklvevdspeealaaLaaGrvDaa
00463701   1/1  .slddLkGkksChtglgstagwliPiglllkeglipvkdddl..--------------------------
00431831   1/1  ksiadLkgpkiallfdpeddfkgrilgiepGwgcealilqalkaygld..ddvklvegseaamlaelaaa
00461181   1/1  geplnlsllkselagyyavavVkkd---------------------------------------------
00463711   1/1  glrlleepdadpgyyavavVkkdsg---------------------------------------------


                         -         -         -         +         -         -         -:280
query           IVASLNEQWKEMSDSKMGYPQSSVIVKEDLAKNNSEAVQKILKEIDNSTKWANENKEEAGAFAEEVGITG
00510901   1/1  nanaa.leaglrvladsldieg.....gpslyvnvlvvrkd..dknpelvkallkallsp----------
00499871   1/1  laaaiaelaaggglrllpldddlldallealpyylpatipagtypglpedvptvavpavlvark------
00523571   1/1  vvlDlgelweeltg..lplplgvlvarrdl...dpelvaallralrkaleyalahpeeaaellakrlpel
00515391   1/1  palllgevdaglligesaltyakagl..lvvldlgelWkeltg..lplPlgvlvvrrdlaeelaeeleea
00468571   1/1  dv--------------------------------------------------------------------
00422011   1/1  daavinnnyalaagld.......plkdallledkdsillkpyinlivvrke.dkdneaikklve------
00387041   1/1  vlayllkkgpllala-------------------------------------------------------
00504461   1/1  layllkklplddlkv-------------------------------------------------------
00406501   1/1  vlayllkklpllgll-------------------------------------------------------
00510991   1/1  vtdepvlayllkqlpdlkvgvgepls...........seplgiavrkg.dpelldal-------------
00463701   1/1  ----------------------------------------------------------------------
00431831   1/1  ykrgepivfygwsPhwmfakyvpgedlkyLedpkgafgpykvl.....dsdladgkvlgfpastv-----
00461181   1/1  ----------------------------------------------------------------------
00463711   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           KKEIIAKSLERANLNYVSALDSESEYIKYYDKIYSLEPKAIGGKKVNEEIFLQK----------------
00510901   1/1  ----------------------------------------------------------------------
00499871   1/1  ----------------------------------------------------------------------
00523571   1/1  daellrealklyvnelsydlgeegrealqrfaellaelg...llpklpdld-------------------
00515391   1/1  lrk...sveyalenpeealeyale----------------------------------------------
00468571   1/1  ----------------------------------------------------------------------
00422011   1/1  ----------------------------------------------------------------------
00387041   1/1  ----------------------------------------------------------------------
00504461   1/1  ----------------------------------------------------------------------
00406501   1/1  ----------------------------------------------------------------------
00510991   1/1  ----------------------------------------------------------------------
00463701   1/1  ----------------------------------------------------------------------
00431831   1/1  ----------------------------------------------------------------------
00461181   1/1  ----------------------------------------------------------------------
00463711   1/1  ----------------------------------------------------------------------