[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cper0:BAB81206.1


[Show Plain Result]

## Summary of Sequence Search
   1::440
 290::434  3.2e-08 18.0% 0038974 00389741 1/1   e domain of HSP90 chaperone/DNA topoiso 
 287::437    1e-07 19.0% 0052097 00520971 1/1   e domain of HSP90 chaperone/DNA topoiso 
 292::434    2e-07 18.2% 0035339 00353391 1/1   e domain of HSP90 chaperone/DNA topoiso 
 313::422  1.1e-05 23.6% 0043939 00439391 1/1   e domain of HSP90 chaperone/DNA topoiso 
 296::436  0.00011 16.3% 0043142 00431421 1/1   e domain of HSP90 chaperone/DNA topoiso 
 288::436  0.00015 17.6% 0051393 00513931 1/1   e domain of HSP90 chaperone/DNA topoiso 
 284::440  0.00027 20.4% 0038146 00381461 1/1   e domain of HSP90 chaperone/DNA topoiso 
 295::437  0.00041 17.5% 0040344 00403441 1/1   e domain of HSP90 chaperone/DNA topoiso 
 283::436  0.00062 13.9% 0046033 00460331 1/1   e domain of HSP90 chaperone/DNA topoiso 
 304::420  0.00093 18.8% 0035784 00357841 1/1   e domain of HSP90 chaperone/DNA topoiso 
   1::440


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLMNQMFWDFMENASMIIEWVSFYLIISQFSPKKRKNKQEVYSFIVIIIFSVLLKVLNVYPNERIVICFF
00389741   1/1  ----------------------------------------------------------------------
00520971   1/1  ----------------------------------------------------------------------
00353391   1/1  ----------------------------------------------------------------------
00439391   1/1  ----------------------------------------------------------------------
00431421   1/1  ----------------------------------------------------------------------
00513931   1/1  ----------------------------------------------------------------------
00381461   1/1  ----------------------------------------------------------------------
00403441   1/1  ----------------------------------------------------------------------
00460331   1/1  ----------------------------------------------------------------------
00357841   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           IGLIYYKFNFRVNNIKCIMISLIFWLFMLTVEALSISFIVKINSLVNVSDLLGKNIYRMETMILSKVILI
00389741   1/1  ----------------------------------------------------------------------
00520971   1/1  ----------------------------------------------------------------------
00353391   1/1  ----------------------------------------------------------------------
00439391   1/1  ----------------------------------------------------------------------
00431421   1/1  ----------------------------------------------------------------------
00513931   1/1  ----------------------------------------------------------------------
00381461   1/1  ----------------------------------------------------------------------
00403441   1/1  ----------------------------------------------------------------------
00460331   1/1  ----------------------------------------------------------------------
00357841   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           SLIMVVRCLKFRVDIGKGDFIYILTPIATNIIIILVIFGYAFKGGREGFGDNVSIFFVSILLLLSNMSLM
00389741   1/1  ----------------------------------------------------------------------
00520971   1/1  ----------------------------------------------------------------------
00353391   1/1  ----------------------------------------------------------------------
00439391   1/1  ----------------------------------------------------------------------
00431421   1/1  ----------------------------------------------------------------------
00513931   1/1  ----------------------------------------------------------------------
00381461   1/1  ----------------------------------------------------------------------
00403441   1/1  ----------------------------------------------------------------------
00460331   1/1  ----------------------------------------------------------------------
00357841   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           FIVSKIIKNNKLKLENEFIKDKLEMEYKYYSNLKDNQEKVKRLYHDIKNHIACIEGNNKETGIRKKYIDS
00389741   1/1  ----------------------------------------------------------------------
00520971   1/1  ----------------------------------------------------------------------
00353391   1/1  ----------------------------------------------------------------------
00439391   1/1  ----------------------------------------------------------------------
00431421   1/1  ----------------------------------------------------------------------
00513931   1/1  ----------------------------------------------------------------------
00381461   1/1  ----------------------------------------------------------------------
00403441   1/1  ----------------------------------------------------------------------
00460331   1/1  ----------------------------------------------------------------------
00357841   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           LNSEIDKLNLGFNTGNEVLDVILNNKREKCMENNISLKVFIDFSKVNFIEYFDICTIFSNCIDNAIEACK
00389741   1/1  ---------lepvdlaelleevlellrllaeekgielvleldpdlpvlgdplllrqvllnllsNAikyt.
00520971   1/1  ------elelepvdlaelleevlellrllaeekgieleleldpdllllvlgdplllrqvllnLlsNAiky
00353391   1/1  -----------pvdlaelleellellrllaeekgieleleldgdelllvlgdplllrqvllnllsNAiky
00439391   1/1  --------------------------------lniqlevdglldiligsdysrleqvlreLisNAiDAla
00431421   1/1  ---------------aepvdlaelleevlellrlla.ekgielvldlapdlplvlgdplllrqvllnLls
00513931   1/1  -------eelepvdlaelleevlellrllaeekgieleldldlp..vlgdplllrqvllnLlsNAiky..
00381461   1/1  ---gklelelepvdlaelleellellrllaeekglelielvldldllllvlgdplrlrqvllnLlsNAik
00403441   1/1  --------------laelleellelllllag.kgielvldldedlplvladallleqvllnllsNAikha
00460331   1/1  --grlelelepvdlaelleevlellrll...ekgielvldld.lllvlgdplllrqvllnLlsNAikyt.
00357841   1/1  -----------------------lelkaiaeklgielevdrlldilagslysnleivlrELisNAiDAla


                         -         -         -         -         *         -         -:420
query           KIKDNNRYISLKGNCVNNFYVIKIENSKTNKIKKLNGDFLTDKKDKFLHGIGLKNIRLALEKYNGEIIIE
00389741   1/1  ...peg..itvslrllgdllvlsveDnGpgipeellerifepfyrtdssrggtGlGLaivkeivelhggt
00520971   1/1  t....peggllltitvslrlegdlvvisveDnGiGipeellerifepffrtdssrsrelggtGlGLaivk
00353391   1/1  tielleerlalgkpeggtitvslrregdrvvievsDnGiGipeelllekalekgllseeellslselell
00439391   1/1  klvlllltdgkklaeggeitirikldkdnvlltvtDnGiGiteedlkkifepfatsktkgflealkaggk
00431421   1/1  NAikyt...epeggtitvslrlllllllllllegdlvvlsvsDnGpGipeellerifepffrtds..ggt
00513931   1/1  ..tp.ggtitislrlegdlvvlsveDnGpgipeellerifepffrtdssrsggtGlGLaivkrivelhgg
00381461   1/1  atpegleegklelgtitvslrlegdlvvisvsDnGiGippedlerifepffttkeaglsdlellnllllp
00403441   1/1  leg.peggtitislrlegglvvltvrDnGigipelerifepffttkesrggtGlGLaivke....hggei
00460331   1/1  .....ggtitvslrlegdlvvlsvsDnGiGipeellerifepffrtdssrdlggtGlGLaivkrivelhg
00357841   1/1  klrlilltdeklageggeitirllpdkeeltltvsDnGiGitkedlinifgtfatsgkkgfleylvdgsd


                         -         -         +         -         -         -         -:490
query           PLDDKFILKMLIPINQEKEA--------------------------------------------------
00389741   1/1  itvesepgggttft--------------------------------------------------------
00520971   1/1  eivelhggtitvesepg-----------------------------------------------------
00353391   1/1  erifepffrtkssr--------------------------------------------------------
00439391   1/1  ed--------------------------------------------------------------------
00431421   1/1  GLGLaivkrivelhgg------------------------------------------------------
00513931   1/1  tisvesepgggttftl------------------------------------------------------
00381461   1/1  glslaslvrdlgGtGlGLai--------------------------------------------------
00403441   1/1  tvesepgggttftitlP-----------------------------------------------------
00460331   1/1  gtitvesepgggttft------------------------------------------------------
00357841   1/1  ----------------------------------------------------------------------