[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cper0:BAB81382.1


[Show Plain Result]

## Summary of Sequence Search
   1::796
 403::697    2e-59 33.6% 0036857 00368571 1/1   p containing nucleoside triphosphate hy 
 724::793  2.7e-24 62.9% 0053153 00531531 1/1   ed helix" DNA-binding domain            
 724::792  2.2e-23 60.9% 0053154 00531541 1/1   ed helix" DNA-binding domain            
 452::728  8.5e-20 21.5% 0043798 00437981 1/1   p containing nucleoside triphosphate hy 
 100::734  9.4e-17 21.0% 0043792 00437921 1/1   p containing nucleoside triphosphate hy 
 636::741  2.5e-08 26.3% 0043001 00430011 1/1   ic acid-binding proteins                
 220::616  3.8e-06 20.5% 0050356 00503561 1/1   p containing nucleoside triphosphate hy 
 422::623    6e-06 14.9% 0052726 00527261 1/1   p containing nucleoside triphosphate hy 
 453::623  0.00013 19.2% 0043794 00437941 1/1   p containing nucleoside triphosphate hy 
 429::638   0.0004 22.9% 0047420 00474201 1/1   p containing nucleoside triphosphate hy 
   1::796


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAGGKKKTATKTQKKKNQSQIKVTEEIYALIAICVSLIVMFSLYTDKAGYLSVISRTLLIGLFGIGAFFI
00368571   1/1  ----------------------------------------------------------------------
00531531   1/1  ----------------------------------------------------------------------
00531541   1/1  ----------------------------------------------------------------------
00437981   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00430011   1/1  ----------------------------------------------------------------------
00503561   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           PIYIIYLCTKLFLFKREVLFSRIGLGITIALITSVLLIQTVNINDYYVQGSIWGSIKTIWHSQSEWHGGV
00368571   1/1  ----------------------------------------------------------------------
00531531   1/1  ----------------------------------------------------------------------
00531541   1/1  ----------------------------------------------------------------------
00437981   1/1  ----------------------------------------------------------------------
00437921   1/1  -----------------------------lglllveklrpkllddvvgqeealerlllalkagk......
00430011   1/1  ----------------------------------------------------------------------
00503561   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           VGFLIVLPLYKLVGKIGLFVIFVTLYLISSMLIFDYNLVSIRNFFGGFKEKASKVKFVDKKYEKDDYINL
00368571   1/1  ----------------------------------------------------------------------
00531531   1/1  ----------------------------------------------------------------------
00531541   1/1  ----------------------------------------------------------------------
00437981   1/1  ----------------------------------------------------------------------
00437921   1/1  ......................................................................
00430011   1/1  ----------------------------------------------------------------------
00503561   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           KKKDGASEGNKESKKDDISEDNNKIKILDFMKNSSLNDIEDNKKEKDNQLKDNIKINDFKQESKMPRDLS
00368571   1/1  ----------------------------------------------------------------------
00531531   1/1  ----------------------------------------------------------------------
00531541   1/1  ----------------------------------------------------------------------
00437981   1/1  ----------------------------------------------------------------------
00437921   1/1  ......................................................................
00430011   1/1  ----------------------------------------------------------------------
00503561   1/1  ---------kPydrLldivgigfltaddialalgiagdsperlllalallsellgeghlylplddlveel
00527261   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           LDNTIIEQRGFNSEKAKEEESIDKEISNNIASKGSSVGASYVAPNADLLNLNNNNELDKDDKKALLANAA
00368571   1/1  ----------------------------------------------------------------------
00531531   1/1  ----------------------------------------------------------------------
00531541   1/1  ----------------------------------------------------------------------
00437981   1/1  ----------------------------------------------------------------------
00437921   1/1  ......................................................................
00430011   1/1  ----------------------------------------------------------------------
00503561   1/1  lklleldelllelieleellkelleeilvellkedlelvlderrlyleeleldelglaellkelleelei
00527261   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           KLEETLMSFGVEAKILQVTKGPSVTRFELQPKAGIKVSKIVNLADDIALGLAAKGVRIEAPIPGKSAIGI
00368571   1/1  ----------------------------------------------------llgvrllpplppklagll
00531531   1/1  ----------------------------------------------------------------------
00531541   1/1  ----------------------------------------------------------------------
00437981   1/1  ----------------------------------------------------------------------
00437921   1/1  ......................................................................
00430011   1/1  ----------------------------------------------------------------------
00503561   1/1  deklldkilddle.........................................................
00527261   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           EVPNKEQTPVFFREIVESKEFLDNKFKVACALGKDITGKAVVTDLSKMPHVLIAGATGSGKSVCINTLIV
00368571   1/1  plagladgd.................glgvllGklldgvpvtldlgelgrhllivGptGsGKStllrlla
00531531   1/1  ----------------------------------------------------------------------
00531541   1/1  ----------------------------------------------------------------------
00437981   1/1  -------------------------------lveklrpknldkvigqeealkdlslalkpgeiphalllv
00437921   1/1  ...............................................lphlllvGppGvGKTtlaralar
00430011   1/1  ----------------------------------------------------------------------
00503561   1/1  ......................................................................
00527261   1/1  -npfilgpkvdledfigreeelkeleeal.................p.kivlltGprGsGKTtllkalak
00437941   1/1  --------------------------------lrplveklrpknlddvygqeevlkalslalekgrpehl
00474201   1/1  --------deelelleklslllveklrpvllddlvgqeeakeallealr..............agrpghv


                         *         -         -         -         -         +         -:560
query           SILYKYSPDEVKLLMIDPKVVELNVYNGIPHLLIPVVTDPKKAAAALNWAVNEMTRRYKLFADNGVRNIE
00368571   1/1  glllpd....ggrviviDpkgeyaglarglgvvildpgdgrsvrlnplaliddeedaaellralvsemgr
00531531   1/1  ----------------------------------------------------------------------
00531541   1/1  ----------------------------------------------------------------------
00437981   1/1  GppGsGKttlaralagll....gpdsgkilldgkdi.....rrgiglvfqliglfphltvlelvalglgg
00437921   1/1  ll..lgsgggvdvielda....................sdlrgvddlreligevlqalglllgg......
00430011   1/1  ----------------------------------------------------------------------
00503561   1/1  .....................gilplnpeQkeaieailkgrvvliqGppGtGKTtlalaliaellkelkg
00527261   1/1  el.......gkpviyidlselsskgyvdleellrelaeelgellellkkllkklsellglsilglelilg
00437941   1/1  llvGppGtGKT....tlakalaglllptsggvrvlgidaselld..........................
00474201   1/1  llvGppGtGKT.....tlaralanelprs....lpglpfvrvnasdltdvglleellgkllgaat.....


                         -         -         -         *         -         -         -:630
query           SYNALYNKGEVPEKLPYIVIIVDELADLMMACPHDVEDYICRLAQMARAAGMHLVIATQRPSVDVITGVI
00368571   1/1  geddfftpaarallralilalaeepeptldellellselglrdladrleklvagglagllegaektaasi
00531531   1/1  ----------------------------------------------------------------------
00531541   1/1  ----------------------------------------------------------------------
00437981   1/1  ilveevrellkel..............lsgGqkqrvaiaralagdpkvlllDEptaldpdaqnaLlklle
00437921   1/1  ...............kpdvlllDEi.drl...dpdaqnallklleel.pagvtlilttnrle..ellpal
00430011   1/1  ----------------------------------------------------------------------
00503561   1/1  kgkrilvlaptraaaeqlaerlkkllgklvlllvlalllgvevgtlh.........--------------
00527261   1/1  lsggdleelleelaellkk.lgkpvililDEiqslldvsskelleaLlrlldegk..nvtiil-------
00437941   1/1  ................pselsggerqrvliaralladpkvlllDEi.dal...dpeaqnaLlk-------
00474201   1/1  ...............................fllakpgvlflDEidkl....dpdvqnaLlrlle.elps


                         -         +         -         -         -         -         *:700
query           KANIPSRISFAVSSQIDSRTILDSAGAEKLLGRGDMLFYPVGESKPQRVQGAFISEEEVEHVVSFIKESQ
00368571   1/1  lellrkllallldlggpafdlrdllslgeglivlillslggekqrvalarallsllfeallelggrl---
00531531   1/1  ----------------------------------------------------------------------
00531541   1/1  ----------------------------------------------------------------------
00437981   1/1  elak.....gvtvilathdls..ellpallsrcq.virfpplseeelleildril...............
00437921   1/1  lsrfd.iiefkplseeelleilkrilee.....................egvklsdealealaels...g
00430011   1/1  -----evmelpspringsllaqfvgktVrivgkvtklrgtgnvlilvdgdgknvtirllepldlevggvv
00503561   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00474201   1/1  nvrviatt--------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           RDAQYEEDILEHINSATIASEGNGDGDRDELLDEAIEIVVESGQASASYLQRRLRIGFNRAARIIEELEE
00368571   1/1  ----------------------------------------------------------------------
00531531   1/1  -----------------------ddeeedelydeavelvlesgkasisllqrrlriGynrAarlieqlee
00531541   1/1  -----------------------dddeedelydeavelvleegkasvsllqrrlriGynrAarlieqlee
00437981   1/1  .....vleggklvedgaleelael...s------------------------------------------
00437921   1/1  gdpraalnlleraaa...grelitledvkellge------------------------------------
00430011   1/1  evi......Gkvspd.ltiraltyiefgedgaefdlelyne-----------------------------
00503561   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           CGVISRRDGSKPRQVLLSKDELENMK--------------------------------------------
00368571   1/1  ----------------------------------------------------------------------
00531531   1/1  egivgpaegskpRevlvseedle-----------------------------------------------
00531541   1/1  egivgpaegskpRevlvseedl------------------------------------------------
00437981   1/1  ----------------------------------------------------------------------
00437921   1/1  ----------------------------------------------------------------------
00430011   1/1  ----------------------------------------------------------------------
00503561   1/1  ----------------------------------------------------------------------
00527261   1/1  ----------------------------------------------------------------------
00437941   1/1  ----------------------------------------------------------------------
00474201   1/1  ----------------------------------------------------------------------