[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cper0:BAB81490.1


[Show Plain Result]

## Summary of Sequence Search
   1::142
   1::122  1.9e-47 50.4% 0050992 00509921 1/1   NifU                                    
   5::131    6e-45 50.8% 0050511 00505111 1/1   NifU                                    
   1::131    4e-44 46.2% 0042614 00426141 1/1   NifU                                    
   2::117  6.7e-42 51.3% 0043760 00437601 1/1   NifU                                    
   1::142


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MIYSEKVMDHFKNPRNVGEIKDANGIGEVGNAKCGDIMRIYLKIENNIVEDVKFETYGCGSAIASSSMAT
00509921   1/1  llllldlddlysevildhaknprnvglledada.aevgnplcGDtvtlylkvddgriedakfegfGCais
00505111   1/1  ----ekildhalnprnvglledadllvatgevgnplcGDtvtlylkvdedgvIedakfkgfGCaisiAsa
00426141   1/1  dlYsekildhylnprnvglledadallatgevgnplcGDvvtlylkvdddgiitdakfkgfGcaiaiAsa
00437601   1/1  -lddlysekildhalnprnvglledada.aevgnplCGDtvtlylkvddgritdakfegfGCaisiAsas


                         -         -         *         -         -         -         -:140
query           ELIKGKTVEEAWELSNKAVAEALDGLPPVKMHCSVLAEEAIHKAINDYRQRQGLEPWDMKEHSHDIHEHV
00509921   1/1  iAsaslltelvkgktleealellnefiamllgglppdeallgdlavlagvrk------------------
00505111   1/1  slltelvkGktleealelgdldvlealg.lpparihcalLawdalkaaledylgkqgldee---------
00426141   1/1  slltelvkGktleealklgdldilealr.lpparlkcallaldalkealedyegkrledse---------
00437601   1/1  lltelvkgktleealkllnkfiamllgglppeedllgdlavlagvrk-----------------------


                         +         -         -         -         -         *         -:210
query           HG--------------------------------------------------------------------
00509921   1/1  ----------------------------------------------------------------------
00505111   1/1  ----------------------------------------------------------------------
00426141   1/1  ----------------------------------------------------------------------
00437601   1/1  ----------------------------------------------------------------------