[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cper0:BAB81560.1


[Show Plain Result]

## Summary of Sequence Search
   1::219
   1::214    3e-75 47.4% 0046211 00462111 1/1   inding barrel                           
   3::219  1.6e-51 36.4% 0045930 00459301 1/1   inding barrel                           
   3::218  2.9e-49 29.3% 0050171 00501711 1/1   inding barrel                           
   3::216    7e-23 21.3% 0049723 00497231 1/1   inding barrel                           
   3::218  1.9e-22 18.5% 0038618 00386181 1/1   inding barrel                           
   3::220  2.5e-21 22.0% 0049144 00491441 1/1   inding barrel                           
  10::207  1.9e-07 17.3% 0040168 00401681 1/1   inding barrel                           
   3::209  0.00016 20.4% 0046278 00462781 1/1   inding barrel                           
   3::213  0.00024 19.0% 0053309 00533091 1/1   inding barrel                           
   1::219


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDIKENLTKFTEKIPSNVQLIAVSKTRTIEEMEEAYEFGIRKFGENKVQEIIRKFDEFHQDVEWHLIGHL
00462111   1/1  eellllelrlseiaenleavleriaaaalklkagrdpdsvrLlaVsKtvpaeairalyeaGqrlfGenrv
00459301   1/1  --idldalrhniralkelagrgvkllavvKanAYGhgaveiakalleaGargfgvatvqEalelreagi.
00501711   1/1  --Dldalrhniralreaag.gvkllavvKanAYGhgalavaralleaGargfgvaslqEalalreagida
00497231   1/1  --lreniralkeafpggvkvfyavKanpnpavlkllaelgagfdvaslgElllalaagvpperiifagpg
00386181   1/1  --dldalrrnirrlraalpggvrlvyavKanplpavlellaelglglevaskgElllalaagvpperiif
00491441   1/1  --lrhNlrllrellp..vkllavvKanAYGhgavevakallagadgfavatleEalalreagida.pilv
00401681   1/1  ---------dldaLrrnlealkaalp.........lvyAvKanslpavlellaelglglevaSlgEllla
00462781   1/1  --Dldalrrnlralkeafp.gvkilyAvKansnpavlellaelgagfdvaslgElllalaagvpperiif
00533091   1/1  --Dldalrrnlralkealp.gvkilyAvKansnpavlrllaelgagfdvaslgElllalaagvpperiif


                         -         -         *         -         -         -         -:140
query           QTNKVKYIVDKVHLIQSLDSIKLLKEIEKVYGKHNKIANTLIQVNIGREEQKYGILEEELDELIEAIEAC
00462111   1/1  qealekaealpddiewhfiGhLqsnkvklvaelglfdlihsvdslklaeelnklaeelgeelrplnvllq
00459301   1/1  dipllllgplqsnklklaael.dlihsvdslklaealskaaak.gkplkvllqvdtg..msRlGvlplee
00501711   1/1  .pilflgplqsnklklaael.gliltvdslellealseaaaelgkplrvllkvdtg..msRlGvspeelg
00497231   1/1  ksreeielalelgvliivvdsleelellaelapelgkvakvllrinpgvdagthdyistggldskfGidl
00386181   1/1  agplksreelrlalelgvrlivvdsleeleklaalapelgvplrvllrvnlgasagtgdllstgglgskf
00491441   1/1  lgglfspeelellveldltlvvdsleqlealseaal..gkplkvhlkvDtGmg..RlGlspeellallel
00401681   1/1  lalgvplelspdeiifagpaksdeeielalglgvlivvdsldelerllel....gpklkvglRvnlsvsl
00462781   1/1  sgpaksreeirlalelgvllivvdslselellaelape....agvllrvnpdvdagthgliskfGidlee
00533091   1/1  agpakseeeirlalelgvrlivvdsleelellaelape....akvglRvnpgvdagthgliskfGidlee


                         +         -         -         -         -         *         -:210
query           NNVNVLGIMTIIPKGTEEECRKYFSKTHKLFCELKEKKFKNIKMDILSMGMSGDYEIATEEGSNMVRIGQ
00462111   1/1  vntsgeesksGvlpeellellelllllaelpnlelrGLmtipplgddadleelrelfallreladelkel
00459301   1/1  llelleailalpnlrlvglmthlaladepdleatraqfalfkelaekl......glkllilsmgnSadil
00501711   1/1  ealelleaiaalpglrlvGlmthlglsdeldleafraqlarlleladllkal...gldleilslggsagi
00497231   1/1  eegealellelakelpglelvGlhfhigsqildleafrealerlleladelke...lgidlelldlGGGl
00386181   1/1  Glspeellellellkeakllglrlvglhfhvgsqildaealvealrealelfvelaeklleelglplevl
00491441   1/1  laalpglrlvglmthfasadel.dleltlaqlelflell.....glllllvslanSagilllpeahfdlv
00401681   1/1  gagsllssggesskfGlsldelvellellre.lllrlvglhfHvg..sqildadlfvealalalell---
00462781   1/1  alellelakelg.ldlvglhfHigsqildleallealerllelfdelre...lgldlelldlG..GGlg-
00533091   1/1  alellelakelg.ldlvglhfHigsqildleallealrrllelaerlre...lgidlelldlG..GGlgi


                         -         -         -         +         -         -         -:280
query           GIFGKRLYK-------------------------------------------------------------
00462111   1/1  ll..------------------------------------------------------------------
00459301   1/1  laielgatl-------------------------------------------------------------
00501711   1/1  llaielga--------------------------------------------------------------
00497231   1/1  gipyls----------------------------------------------------------------
00386181   1/1  dlGGGlgv--------------------------------------------------------------
00491441   1/1  RpGialYGls------------------------------------------------------------
00401681   1/1  ----------------------------------------------------------------------
00462781   1/1  ----------------------------------------------------------------------
00533091   1/1  pys-------------------------------------------------------------------