[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cper0:BAB81626.1


[Show Plain Result]

## Summary of Sequence Search
   1::116
   4::116  1.5e-20 34.5% 0040251 00402511 1/1   ike                                     
   4::116  3.4e-20 32.7% 0039276 00392761 1/1   ike                                     
   4::116  9.1e-20 33.6% 0052646 00526461 1/1   ike                                     
   4::116  6.5e-19 33.6% 0045692 00456921 1/1   ike                                     
   4::114  1.8e-16 30.6% 0051642 00516421 1/1   ike                                     
   4::116    7e-16 32.7% 0052100 00521001 1/1   ike                                     
   6::117  1.3e-15 20.7% 0046583 00465831 1/1   ike                                     
   5::118  1.8e-15 31.6% 0047366 00473661 1/1   ike                                     
   4::117  7.4e-15 29.2% 0051240 00512401 1/1   ike                                     
   3::116    2e-14 27.2% 0048732 00487321 1/1   ike                                     
   8::111  2.4e-14 30.3% 0047832 00478321 1/1   ike                                     
   4::113  2.6e-14 31.8% 0042932 00429321 1/1   ike                                     
   6::117  7.1e-13 31.2% 0048699 00486991 1/1   ike                                     
   4::98   1.1e-12 32.6% 0046495 00464951 1/1   ike                                     
   4::106  2.7e-12 31.1% 0048648 00486481 1/1   ike                                     
   6::113  2.7e-12 25.9% 0046585 00465851 1/1   ike                                     
   4::95   6.1e-12 25.0% 0047256 00472561 1/1   ike                                     
   7::116  7.6e-12 24.5% 0050358 00503581 1/1   ike                                     
   6::67   6.7e-11 32.3% 0046753 00467531 1/1   ike                                     
   7::97   1.1e-09 34.1% 0051037 00510371 1/1   ike                                     
   4::100    3e-09 19.6% 0052670 00526701 1/1   ike                                     
   4::109  2.4e-08 28.3% 0046281 00462811 1/1   in prenylyltransferase                  
   4::82   4.8e-08 31.6% 0049644 00496441 1/1   ike                                     
   7::116    5e-05 26.9% 0051253 00512531 1/1   ike                                     
   1::116


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSNFSKGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQDSKYF
00402511   1/1  ---iellekaleldpdnaealkllGnalfklgdyeeAielyekalellpellealleealeldpdnaeay
00392761   1/1  ---ePkdalaylllgllllklgdyeeAlelfekaleldpenaealfnlalallklgdyedveeAiellek
00526461   1/1  ---paeellekaleldpddaeallnlGnalfklgdyeeAielyekalelllkllgleellllddpdnlea
00456921   1/1  ---knlGnalfklgdyeeAielytkaleldpnnaeaylnlalaylklgdyeeAledyekaleldpnnaka
00516421   1/1  ---yllGlallklgdyeeAielyekaleldpdnaeallnlglallklgdyeealealglleeAieayeka
00521001   1/1  ---PenaealkelGnalfklgdyeeAielytkaleldpdnaeaylnlalaylklgdyeeAledyekalel
00465831   1/1  -----eGneaykkkdfdeAikhYteAieldPkditllsnraAaylelgdydealedcekaielgrelrad
00473661   1/1  ----PigdfielspdpvtvsletlekylllaelllnlGnelyelgkyeeAlecykrAlsllpnylealll
00512401   1/1  ---lllgllllelgelekaleayekal.lepndaealfnlawallkssnlgdyeeAielleealkldpen
00487321   1/1  --yeslleellsleelkvlkkqyekelelnpvdadtyfnyawaLvkssnledveeaielLeellrlnsps
00478321   1/1  -------ngygvkgdyeeAlelyekaaelgp..aeayynlglly..lgdyekAleyyekaae.pgnaeay
00429321   1/1  ---lnlaelyeellgdyeeAleyyekalelyesegddplaaeallnladlyaklgdyeeAielyekalel
00486991   1/1  -----lGnalfkeGnyeeAillfqkalkilknyleidpedlklllelqptlllnlalahlklgeydeAve
00464951   1/1  ---lnlGnallklgkyeeAikayekalkldpdnalalyqleaieikpdlalalnnlGllylrlgdydeAi
00486481   1/1  ---dpealfnlGlayyklgdyeeAielyekaaelgpadaqaylglgyllgygvlgdyekAleyykkaael
00465851   1/1  -----eGneafkegdfeeAiklYteAieldPtnavlysNraaaylklgeyeeAledaekaieldpdfaka
00472561   1/1  ---lnlGlallklgrleeAlaafekaleldPdnaeawlnlGlallelgrleeAlaalekaleldpdnaea
00503581   1/1  ------gvlliqigeleeAlqayqraleldpndpkaylnlGlvlaklkeldeAlkvyreaLelnpanaea
00467531   1/1  -----lGatlanlgkseeAveaYnkAlelkPgfvrarynlGisllnlgayeeAaehfleAlslqpes---
00510371   1/1  ------egellglalqelgeyeeaiadydkaleikelldpdyaeayynrGvallslglydeAiadydkAl
00526701   1/1  ---lalgrallalgryeeAiaaleralalwpgdalgdldealwllaealrlepdrleallnlaeallalg
00462811   1/1  ---yhRgwlleklgrleealelydkaleldpknyhaWsyrgwvleklglyeealeyydkaieldpsnnsa
00496441   1/1  ---lnlglalyklgdydkAlklfekalslspdraealynlpdlleslgllyyllgkyeeAiallekalel
00512531   1/1  ------giil..qglldeaialyrkalellpsfarallnLGdlaryrgdyeeAisyYqkAlelnPnngea


                         -         -         *         -         -         -         -:140
query           FNLAYCYSMINNNSKALRYFNLAWALDNADIDCEKAISLILSKISK------------------------
00402511   1/1  lnlalaylklgdyeeAiedyekaleldpdnakalyrlglaylklgd------------------------
00392761   1/1  allkeldpdnpealyylalalyklgdyeeAlkyfekaleldPdnlq------------------------
00526461   1/1  eallnlglaylklgdyeeAledyekaleldpdnakalynlglallk------------------------
00456921   1/1  yynlglallklgdyeeAledyekaleldpnnaeallnlglallklg------------------------
00516421   1/1  leldpdnaealynlglallklgkllglallalgdyeeAieayek--------------------------
00521001   1/1  dpdnakayynlglallklgryeeAleayekaleldpdnaealylnl------------------------
00465831   1/1  ykliakayaRkGnallklgdleeAieayekal.lehrnpevleklre-----------------------
00473661   1/1  ekaieldpdlaevllnlalayyalgrydeAieclkkaleldpdnvkal----------------------
00512401   1/1  lrealyylalayyklgdyekAlkylekaleldpdnlqalnllalill-----------------------
00487321   1/1  lrrellYylAvayyklgdYekAlkyldllLelePdnlqalnlkkli------------------------
00478321   1/1  ynlGllylkGlgvlkdyekAleyyekaaelgpaeayynlGl-----------------------------
00429321   1/1  apdnsllkyglkdallnlglcylalgdyeeAlealekaleldp---------------------------
00486991   1/1  lfrkalelqPndakaflrlglvllnlgdyeeAleyfkkaleldpsdi-----------------------
00464951   1/1  eaykkaikldprlavayvnlglaylelg------------------------------------------
00486481   1/1  gpanaqanlgllylnglgvlkdyekAlkyyekaaep----------------------------------
00465851   1/1  ylRkgaallllgeleeAleayekaleldpnnaelkeglrevek---------------------------
00472561   1/1  lynlglallalgdyeeAlealekal---------------------------------------------
00503581   1/1  lanLgnlllklgryeeAlvaydraLevnPkflealinlgnvlvtlg------------------------
00467531   1/1  ----------------------------------------------------------------------
00510371   1/1  elnPdyaeaynnlGlallqlgeydeAi-------------------------------------------
00526701   1/1  rydeAlaaleralaldPlreralallglal----------------------------------------
00462811   1/1  whnrgfllkklgrlldlelleealeyydkaieldPnnes-------------------------------
00496441   1/1  dPnhteallnlg----------------------------------------------------------
00512531   1/1  ynqLGvlykeqgnlleAlyyYlralaikppfatArnnLgllfeklg------------------------