[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cper0:BAB81632.1


[Show Plain Result]

## Summary of Sequence Search
   1::507
 343::495  3.4e-33 33.6% 0052097 00520971 1/1   e domain of HSP90 chaperone/DNA topoiso 
 329::497  2.8e-32 33.9% 0039624 00396241 1/1   e domain of HSP90 chaperone/DNA topoiso 
 340::495  1.4e-30 29.7% 0038146 00381461 1/1   e domain of HSP90 chaperone/DNA topoiso 
 344::499  9.2e-29 33.3% 0051393 00513931 1/1   e domain of HSP90 chaperone/DNA topoiso 
 348::495    1e-27 31.5% 0035339 00353391 1/1   e domain of HSP90 chaperone/DNA topoiso 
 349::496  2.1e-27 32.1% 0043142 00431421 1/1   e domain of HSP90 chaperone/DNA topoiso 
 340::499  4.1e-27 32.0% 0046033 00460331 1/1   e domain of HSP90 chaperone/DNA topoiso 
 346::495  4.5e-25 34.0% 0038974 00389741 1/1   e domain of HSP90 chaperone/DNA topoiso 
 351::500  3.3e-22 31.4% 0040344 00403441 1/1   e domain of HSP90 chaperone/DNA topoiso 
 377::496  4.2e-22 33.3% 0048223 00482231 1/1   e domain of HSP90 chaperone/DNA topoiso 
 371::496  1.6e-20 27.2% 0043939 00439391 1/1   e domain of HSP90 chaperone/DNA topoiso 
 326::508  6.3e-20 26.9% 0042491 00424911 1/1   e domain of HSP90 chaperone/DNA topoiso 
 256::342  5.4e-19 37.9% 0052096 00520961 1/1   imeric domain of signal transducing his 
 367::496    1e-16 22.5% 0044566 00445661 1/1   e domain of HSP90 chaperone/DNA topoiso 
 365::496  1.1e-16 25.6% 0040105 00401051 1/1   e domain of HSP90 chaperone/DNA topoiso 
 367::496  1.3e-16 26.4% 0043038 00430381 1/1   e domain of HSP90 chaperone/DNA topoiso 
 351::496  1.9e-16 27.0% 0037015 00370151 1/1   e domain of HSP90 chaperone/DNA topoiso 
 386::496  1.3e-15 24.3% 0038465 00384651 1/1   e domain of HSP90 chaperone/DNA topoiso 
 362::496  1.9e-15 21.6% 0035784 00357841 1/1   e domain of HSP90 chaperone/DNA topoiso 
 383::496  3.1e-14 25.5% 0035364 00353641 1/1   e domain of HSP90 chaperone/DNA topoiso 
 264::336  6.5e-14 34.3% 0039683 00396831 1/1   imeric domain of signal transducing his 
 385::496  1.5e-11 22.7% 0043464 00434641 1/1   e domain of HSP90 chaperone/DNA topoiso 
 367::496  9.1e-11 22.5% 0053133 00531331 1/1   e domain of HSP90 chaperone/DNA topoiso 
 387::496  1.3e-07 17.5% 0043462 00434621 1/1   e domain of HSP90 chaperone/DNA topoiso 
   1::507


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKKSISKRLFIITFGIIIFLTLFTMIFQITFFQEFYYKRKSNDLSNAVLKFRALYSYDIKNTDSLYRALS
00520971   1/1  ----------------------------------------------------------------------
00396241   1/1  ----------------------------------------------------------------------
00381461   1/1  ----------------------------------------------------------------------
00513931   1/1  ----------------------------------------------------------------------
00353391   1/1  ----------------------------------------------------------------------
00431421   1/1  ----------------------------------------------------------------------
00460331   1/1  ----------------------------------------------------------------------
00389741   1/1  ----------------------------------------------------------------------
00403441   1/1  ----------------------------------------------------------------------
00482231   1/1  ----------------------------------------------------------------------
00439391   1/1  ----------------------------------------------------------------------
00424911   1/1  ----------------------------------------------------------------------
00520961   1/1  ----------------------------------------------------------------------
00445661   1/1  ----------------------------------------------------------------------
00401051   1/1  ----------------------------------------------------------------------
00430381   1/1  ----------------------------------------------------------------------
00370151   1/1  ----------------------------------------------------------------------
00384651   1/1  ----------------------------------------------------------------------
00357841   1/1  ----------------------------------------------------------------------
00353641   1/1  ----------------------------------------------------------------------
00396831   1/1  ----------------------------------------------------------------------
00434641   1/1  ----------------------------------------------------------------------
00531331   1/1  ----------------------------------------------------------------------
00434621   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           LFELENNAKIGIYSIDSTPKYVPDPANKNSEAVDLLNDIFNELYSDQDFAKTLLNSNSGVTTEFKSRKYS
00520971   1/1  ----------------------------------------------------------------------
00396241   1/1  ----------------------------------------------------------------------
00381461   1/1  ----------------------------------------------------------------------
00513931   1/1  ----------------------------------------------------------------------
00353391   1/1  ----------------------------------------------------------------------
00431421   1/1  ----------------------------------------------------------------------
00460331   1/1  ----------------------------------------------------------------------
00389741   1/1  ----------------------------------------------------------------------
00403441   1/1  ----------------------------------------------------------------------
00482231   1/1  ----------------------------------------------------------------------
00439391   1/1  ----------------------------------------------------------------------
00424911   1/1  ----------------------------------------------------------------------
00520961   1/1  ----------------------------------------------------------------------
00445661   1/1  ----------------------------------------------------------------------
00401051   1/1  ----------------------------------------------------------------------
00430381   1/1  ----------------------------------------------------------------------
00370151   1/1  ----------------------------------------------------------------------
00384651   1/1  ----------------------------------------------------------------------
00357841   1/1  ----------------------------------------------------------------------
00353641   1/1  ----------------------------------------------------------------------
00396831   1/1  ----------------------------------------------------------------------
00434641   1/1  ----------------------------------------------------------------------
00531331   1/1  ----------------------------------------------------------------------
00434621   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           TKYIVYMVPFSLNSKNDSIIIAITSFQAIEEASALIKDFYKYIILIVIVIGLILSYVFSNLISKPLVKLN
00520971   1/1  ----------------------------------------------------------------------
00396241   1/1  ----------------------------------------------------------------------
00381461   1/1  ----------------------------------------------------------------------
00513931   1/1  ----------------------------------------------------------------------
00353391   1/1  ----------------------------------------------------------------------
00431421   1/1  ----------------------------------------------------------------------
00460331   1/1  ----------------------------------------------------------------------
00389741   1/1  ----------------------------------------------------------------------
00403441   1/1  ----------------------------------------------------------------------
00482231   1/1  ----------------------------------------------------------------------
00439391   1/1  ----------------------------------------------------------------------
00424911   1/1  ----------------------------------------------------------------------
00520961   1/1  ----------------------------------------------------------------------
00445661   1/1  ----------------------------------------------------------------------
00401051   1/1  ----------------------------------------------------------------------
00430381   1/1  ----------------------------------------------------------------------
00370151   1/1  ----------------------------------------------------------------------
00384651   1/1  ----------------------------------------------------------------------
00357841   1/1  ----------------------------------------------------------------------
00353641   1/1  ----------------------------------------------------------------------
00396831   1/1  ----------------------------------------------------------------------
00434641   1/1  ----------------------------------------------------------------------
00531331   1/1  ----------------------------------------------------------------------
00434621   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           KSAKKMSAMDFSEKCDIEREDEIGNLAKTLNFLSKNLSNALDDLKIKNKKLEEDIEKERELEKLRKDFIA
00520971   1/1  ----------------------------------------------------------------------
00396241   1/1  ----------------------------------------------------------------------
00381461   1/1  ----------------------------------------------------------------------
00513931   1/1  ----------------------------------------------------------------------
00353391   1/1  ----------------------------------------------------------------------
00431421   1/1  ----------------------------------------------------------------------
00460331   1/1  ----------------------------------------------------------------------
00389741   1/1  ----------------------------------------------------------------------
00403441   1/1  ----------------------------------------------------------------------
00482231   1/1  ----------------------------------------------------------------------
00439391   1/1  ----------------------------------------------------------------------
00424911   1/1  ----------------------------------------------------------------------
00520961   1/1  ---------------------------------------------llalalnealeeleealeakgefla
00445661   1/1  ----------------------------------------------------------------------
00401051   1/1  ----------------------------------------------------------------------
00430381   1/1  ----------------------------------------------------------------------
00370151   1/1  ----------------------------------------------------------------------
00384651   1/1  ----------------------------------------------------------------------
00357841   1/1  ----------------------------------------------------------------------
00353641   1/1  ----------------------------------------------------------------------
00396831   1/1  -----------------------------------------------------aleeleealeaksefla
00434641   1/1  ----------------------------------------------------------------------
00531331   1/1  ----------------------------------------------------------------------
00434621   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           GASHELKTPIGIISGYAEGIKDGIVDHKDQGVYLDIIIDEAEKMNKLVMDMLELSKLEAGKIDLHIIDFS
00520971   1/1  --------------------------------------------------------------elelepvd
00396241   1/1  ------------------------------------------------ndlldlsrleagllelelepvd
00381461   1/1  -----------------------------------------------------------gklelelepvd
00513931   1/1  ---------------------------------------------------------------eelepvd
00353391   1/1  -------------------------------------------------------------------pvd
00431421   1/1  --------------------------------------------------------------------ae
00460331   1/1  -----------------------------------------------------------grlelelepvd
00389741   1/1  -----------------------------------------------------------------lepvd
00403441   1/1  ----------------------------------------------------------------------
00482231   1/1  ----------------------------------------------------------------------
00439391   1/1  ----------------------------------------------------------------------
00424911   1/1  ---------------------------------------------ylvedllvlsrlea...........
00520961   1/1  nvsHELRtPLtailgylelllegllelldeelreyleiilesaerllrlindlldlsrleag--------
00445661   1/1  ----------------------------------------------------------------------
00401051   1/1  ----------------------------------------------------------------------
00430381   1/1  ----------------------------------------------------------------------
00370151   1/1  ----------------------------------------------------------------------
00384651   1/1  ----------------------------------------------------------------------
00357841   1/1  ----------------------------------------------------------------------
00353641   1/1  ----------------------------------------------------------------------
00396831   1/1  nvsHeLrtPLtailgllell......deelrellelileelerllrlvndlldlsr--------------
00434641   1/1  ----------------------------------------------------------------------
00531331   1/1  ----------------------------------------------------------------------
00434621   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           LTELTEEVLVKNSVDINKNNLTVIKNYSPNEDLYVQGDDFKIEQVLTNFVTNAIKYSEPNNQIIIDIKPV
00520971   1/1  laelleevlellrllaeekgieleleldpdllllvlgdplllrqvllnLlsNAikytpeggllltitvsl
00396241   1/1  laelleevlellrlla.ekgielvldldp..lllvlgdplrlrqvllnLlsNAikatpeggleslllpti
00381461   1/1  laelleellellrllaeekglelielvldldllllvlgdplrlrqvllnLlsNAikatpegleegklelg
00513931   1/1  laelleevlellrllaeekgieleldl....dlpvlgdplllrqvllnLlsNAikytp.ggtitislrle
00353391   1/1  laelleellellrllaeekgieleleldgdelllvlgdplllrqvllnllsNAikytielleerlalgkp
00431421   1/1  pvdlaelleevlellrlla.ekgielvldlapdlp.lvlgdplllrqvllnLlsNAikytepeggtitvs
00460331   1/1  laelleevlellrll..ekgielvldld...lllvlgdplllrqvllnLlsNAikyt..ggtitvslrle
00389741   1/1  laelleevlellrllaeekgielvleldpdlp..vlgdplllrqvllnllsNAikytpeg..itvslrll
00403441   1/1  laelleellelllllag.kgielvldldedlp.lvladallleqvllnllsNAikhalegpeggtitisl
00482231   1/1  --------------------------lkilelvrkpplpiivggdprrleqvlrnLvsNAidatakggvi
00439391   1/1  --------------------lniqlevdglldiligsdysrleqvlreLisNAiDAlaklvlllltdgkk
00424911   1/1  ..vrlrpdmyigllelaeekgivleleldellllvlgdvegllqillelldNAidhalagpgairikvtl
00520961   1/1  ----------------------------------------------------------------------
00445661   1/1  ----------------eaeklefqleverlldilvgslysnleivlrELisNAiDAlaklvylsltdgkl
00401051   1/1  --------------kievlgillavrlrpg.liivsgdverlaqvlkeLldNAidaapaggavtirvtld
00430381   1/1  ----------------laesiqfqveierlldilinadysrleqvlrELiqNAiDAgatrveisledegk
00370151   1/1  ldelledliavl......kglelvlkr.pgmlilvtgdatglyrvvqelldNAidhalaggavtisvtld
00384651   1/1  -----------------------------------gedierlasvlkeLvdNAidag..atrievtle..
00357841   1/1  -----------lelkaiaeklgielevdrlldilagslysnleivlrELisNAiDAlaklrlilltdekl
00353641   1/1  --------------------------------fqaeikvlldleavllaagedierlaqvlreLvdNAid
00396831   1/1  ----------------------------------------------------------------------
00434641   1/1  ----------------------------------rylaesiqvlialeevlerpgmyigstgllrvvkel
00531331   1/1  ----------------lleklefqveverlldllikslysnleivlrELisNAiDAlaklvylsltdekl
00434621   1/1  ------------------------------------evveglahvvkelvdNAidaalagkatrievtle


                         -         -         +         -         -         -         -:490
query           EEDKIYFSIENTGAHIPDSDINKIWTQFYRGDTSRNRGSRSTGLGLSIVKNLLQAHESEFGVMNTENGVK
00520971   1/1  rl.egdlvvisveDnGiGipeellerifepffrtdssrsrelggtGlGLaivkeivelhggtitvesepg
00396241   1/1  tvslrl.dgdlvvisvsDnGiGipeellerifepfyrtkssrsldsslrklgGtGLGLaivkrivelhgg
00381461   1/1  titvslrl.egdlvvisvsDnGiGippedlerifepffttkeaglsdlellnllllpglslaslvrdlgG
00513931   1/1  g.dlvvlsveDnGpgipeellerifepffrtdssrs...ggtGlGLaivkrivelhggtisvesepgggt
00353391   1/1  eggtitvslrr.egdrvvievsDnGiGipeelllekalekgllseeellslselellerifepffrtkss
00431421   1/1  lrlllllllllllegdlvvlsvsDnGpGipeellerifepffrtds......ggtGLGLaivkrivelhg
00460331   1/1  g.dlvvlsvsDnGiGipeellerifepffrtdss..rdlggtGlGLaivkrivelhggtitvesepgggt
00389741   1/1  g.dllvlsveDnGpgipeellerifepfyrtdssr....ggtGlGLaivkeivelhggtitvesepgggt
00403441   1/1  rl.egglvvltvrDnGigipe..lerifepffttkesr....ggtGlGLaivke....hggeitvesepg
00482231   1/1  vivvilvivisedgglvritVsDnGiGIppeelpkiferfatskiksfsrliggtGlGlsivkllselhg
00439391   1/1  laeggeitirikl.dkdnvlltvtDnGiGiteedlkkifepfatsktkgflealkaggkedlsdirligg
00424911   1/1  dgdgv.sieVeDnGrGIpveilekifepffeliltvlhaggkfdddsykvsgggtGlGlsivnalsellg
00520961   1/1  ----------------------------------------------------------------------
00445661   1/1  tleggeiriri.lldkdnltltvsDnGiGitkedlekifgtfatskkkgfleklsdladidliGgfGlGl
00401051   1/1  ddg..sltVeDnGrGippedlprlferfytskltvllaggkfddlsykvsggghGlGlsivnalsellgg
00430381   1/1  lgengeitikiladken.vlitvtDnGiGiteedlpkiferfatskkkeflellhagggtdlssrktiGg
00370151   1/1  gdg..sisVeDdGrGippeileriferfyelvltvlhagskfdddsykvsggghGlGlsivnalsellgg
00384651   1/1  dgglllieVsDnGiGipeedleklferfatskisgfddlssrvtlGfrGlGlasvkalsellggtitrdg
00357841   1/1  ageggeitirllp.dkeeltltvsDnGiGitkedlinifgtfatsgkkgfleylvdgsdvsliggfGlGl
00353641   1/1  ag..agrievsle..dgglvlitVrDnGiGipeddlprlferfatskissfddlsyivsiGgrGlGlasv
00396831   1/1  ----------------------------------------------------------------------
00434641   1/1  vdNAidaalaggavrievtldddg..sisVeDdGrGipvdilpkifepfveliltvlhagskfddlsykv
00531331   1/1  lgeggeilirilp.dkdavtltirDnGiGmtkedlekilgtiatsgkkgfleklddkadrsliGqfGlGl
00434621   1/1  adg..sieViDnGrGipvdilplykvsg...........glhGvGlsvvnalsellggtvtrdgkvylql


                         *         -         -         -         -         +         -:560
query           FYFTLKKSKEIDEVEEI-----------------------------------------------------
00520971   1/1  kGttf-----------------------------------------------------------------
00396241   1/1  titvese---------------------------------------------------------------
00381461   1/1  tGlGL-----------------------------------------------------------------
00513931   1/1  tftltlpla-------------------------------------------------------------
00353391   1/1  rsr.l-----------------------------------------------------------------
00431421   1/1  gtieve----------------------------------------------------------------
00460331   1/1  tftltlpla-------------------------------------------------------------
00389741   1/1  tftlt-----------------------------------------------------------------
00403441   1/1  ggttftitlP------------------------------------------------------------
00482231   1/1  geitve----------------------------------------------------------------
00439391   1/1  fGlGla----------------------------------------------------------------
00424911   1/1  gtvevks..ggttftitl----------------------------------------------------
00520961   1/1  ----------------------------------------------------------------------
00445661   1/1  ysvfav----------------------------------------------------------------
00401051   1/1  titvds----------------------------------------------------------------
00430381   1/1  fGlGls----------------------------------------------------------------
00370151   1/1  titrdg----------------------------------------------------------------
00384651   1/1  kvatrl----------------------------------------------------------------
00357841   1/1  ysvfal----------------------------------------------------------------
00353641   1/1  ralael----------------------------------------------------------------
00396831   1/1  ----------------------------------------------------------------------
00434641   1/1  sgglhG----------------------------------------------------------------
00531331   1/1  ysvflv----------------------------------------------------------------
00434621   1/1  fsrgvp----------------------------------------------------------------