[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cper0:BAB81731.1


[Show Plain Result]

## Summary of Sequence Search
   1::434
 128::361  2.9e-57 32.1% 0048596 00485961 1/1   al SAM enzymes                          
 142::408  1.3e-29 23.0% 0049709 00497091 1/1   al SAM enzymes                          
 143::368  1.1e-22 22.7% 0043105 00431051 1/1   al SAM enzymes                          
   1::434


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKVAFATLGCRVNTYESEAMTEKFVREGYEVVDFNEMADVYVVNTCSVTNMGDKKSRQIIGRARRQNPEA
00485961   1/1  ----------------------------------------------------------------------
00497091   1/1  ----------------------------------------------------------------------
00431051   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           IIAVVGCYAQIAPTEVSGIEGVDVVLGSRNKGEIVYYVNKARDEGKQQVKVGAVLKNKVFEDLKIEEYNN
00485961   1/1  ---------------------------------------------------------kvyklplaeifsd
00497091   1/1  ----------------------------------------------------------------------
00431051   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           KTRAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRSLAEHGFKEIILSGIHTASYGVDLDEKVT
00485961   1/1  plslyihi.pgCpnrCtyCdfpsivtkrgklrsryleallkeiellaallggrgvkeiylgGgtptllgp
00497091   1/1  -aplfdlfgrppltlllevtnrCNlrCsyCyapagpglelrplvrerelsleeilrlidelaelgvkevv
00431051   1/1  --gegltleealallrlpllellceaakcprrdrfgrrvtltllisvktngCplrCkyCavsagsgtglk


                         -         -         -         +         -         -         -:280
query           LVDLLEEIEKIDGIERVRIGSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYE
00485961   1/1  d.....qleellealrelfpldgdveitl.etrpdtlddelldllkeag..vnrlslgvQsfddevlkai
00497091   1/1  ltG...GEPllrpd....leelieylkelggllrvsltT.NGtllt....elaeelkeagldrvnisldg
00431051   1/1  kprllspeeileeakaaaelGvkrvvltg...gepllrpdgaeylleliraikel.gle....itttngl


                         -         *         -         -         -         -         +:350
query           DIVNLLRDKIEDVSITTDVIVGFPGETDEEFEETYEFLKRIALSKTHIFKYSPRKGTRAENMENQVDGNK
00485961   1/1  nRghtveevleavelareagfd.sinldlIyGlPgetledfletlelalelgpdhlslyplspepgtpla
00497091   1/1  ldpethdkirgvkgsfekvleaiellreagi...pvkintvvlpgenddeleelldllkelgvdlvfifp
00431051   1/1  ldeelleelkea..Gldrvnlslet.dpelykkirpghtyedvlealerarea..Gikvksglilgl.ge


                         -         -         -         -         *         -         -:420
query           KDERSKKLIELNRINEKAFAEKYIGEVIDVLFEEEVELGSGVYTGYTRNYIKVNAKADCNVSGKILNVKI
00485961   1/1  klyekglplpd-----------------------------------------------------------
00497091   1/1  lvpvggtplarlpllspeeileellaalillpksrlrlglparrgkipllllllgfia------------
00431051   1/1  tdeellellellrelgkr----------------------------------------------------


                         -         -         +         -         -         -         -:490
query           NSFEGEVAEGEIVL--------------------------------------------------------
00485961   1/1  ----------------------------------------------------------------------
00497091   1/1  ----------------------------------------------------------------------
00431051   1/1  ----------------------------------------------------------------------