[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cper0:BAB81831.1


[Show Plain Result]

## Summary of Sequence Search
   1::202
   1::201  8.7e-59 38.8% 0048452 00484521 1/1   otidylyl transferase                    
   1::202  6.3e-58 35.6% 0047860 00478601 1/1   otidylyl transferase                    
   1::200  1.1e-54 34.7% 0039908 00399081 1/1   otidylyl transferase                    
   2::201  1.4e-51 36.2% 0047774 00477741 1/1   otidylyl transferase                    
   1::203  2.2e-49 39.7% 0050866 00508661 1/1   otidylyl transferase                    
   3::203  2.4e-37 36.6% 0037452 00374521 1/1   otidylyl transferase                    
   1::203  4.1e-37 35.0% 0048499 00484991 1/1   otidylyl transferase                    
   3::201  9.7e-37 33.5% 0046569 00465691 1/1   otidylyl transferase                    
   1::197  1.7e-36 33.5% 0050045 00500451 1/1   otidylyl transferase                    
   3::198  6.1e-35 35.1% 0044869 00448691 1/1   otidylyl transferase                    
   2::198  3.2e-34 31.8% 0043997 00439971 1/1   otidylyl transferase                    
   3::199  1.2e-32 34.4% 0045888 00458881 1/1   otidylyl transferase                    
   2::187  4.5e-31 28.5% 0048046 00480461 1/1   otidylyl transferase                    
   3::197  1.3e-30 31.8% 0048544 00485441 1/1   otidylyl transferase                    
   4::187    6e-30 32.7% 0048216 00482161 1/1   otidylyl transferase                    
   2::202  1.7e-29 29.7% 0047586 00475861 1/1   otidylyl transferase                    
   2::175  1.1e-25 31.0% 0036094 00360941 1/1   otidylyl transferase                    
   2::198  2.7e-23 25.8% 0046940 00469401 1/1   otidylyl transferase                    
   1::202


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKKIGVFGGTFDPIHIGHIYIAYEAYKILELDEVIFMPAGNPPHKKWKDITDEIIRYEMVKKAIEPYSFF
00484521   1/1  skmkkiallgGsFdPiHlGHlalleralellegldevivvvtsdpplkdvlkkkplfsleeRlemlrlal
00478601   1/1  kmkkialfgGsFdPvHlGHlalleralellgeldelivvvasdnphprlkgkpplfsleeRlemlrlalk
00399081   1/1  kmmkivlfgGtFDpiHlGHlrlleralelldlvvvgllpdpsnplkk.kplfsleeRlemlelalkgvdr
00477741   1/1  -gmkivlagGtFdpvHlGHlalleralelagldelivvvstfephkgkkplfsleeRlemlelalkgvdr
00508661   1/1  nddfkdlrltPaelrelfkelgwigvvgfgtfnPiHrgHellllrialevadllgldevlllpplvgphk
00374521   1/1  --kivlvgGtFdpfHlGHlalleralela..delivgvssdpphkgkkplfsleeRlemlrlaladvdlv
00484991   1/1  l.kivllgGtFdplHlGHlalleralel..ldelivvvtsd.phk..rplfsleeRlemlelalkgvdrv
00465691   1/1  --rivllgGtFdplHlGHlallerakkla..delivgvtsdplpkkkkplfsleeRlemleaalkgvgld
00500451   1/1  ldkliltpaelrellkelgakkivgfg.TfnplHrGHlalakaale..kldkvvvspfvnplkfg..dl.
00448691   1/1  --kialfgGsFdplHlGHldlleralelf..delivgvtsdppkk...plfsleeRlemlelalkdvdnv
00439971   1/1  -kkialfgGsFdplHlGHldlleralalf..devivvvfvnppkk...plfsleeRlamlelalagvdnv
00458881   1/1  --kivllgGtFdpiHlGHlalleralkl..ldelivgvt.sdplk..kplfsleeRlemlklalkgvdnv
00480461   1/1  -ekkivllgGtFdplHlGHlallerakkla..dklivgvtsdpplprlvfnkdkkkplfsleeRlellea
00485441   1/1  --vivlvgGtFdplHlGHlalleralel..ldelivgvssdp.akkgkplfsleeRlemlelalkgvdrv
00482161   1/1  ---v.ltgGtFDplHlGHlalleralelallgldevvlvvgvnspkkvlf...sleerlamleerlella
00475861   1/1  -ddlrltpaelrelfkekgwkivvafgtfnPvHrgHeallkrAlelldldglllhpl.vgplk..kgdip
00360941   1/1  -kkivlvgGtFDplHlGHlallerakelgdllivgvlsdelvprkkkkplfsleeRlemlea.......l
00469401   1/1  -fmklrltpaelrellkelgagkvva.f.pTfnplHrGHllllvraa...lelndvvlvsilvnptkfg.


                         -         -         *         -         -         -         -:140
query           SINNYEIEKKGLSFTYETLRYLHESFKEVELYFITGADCLVNLNSWKNINEIFKFSNLVVFNRPGFDKND
00484521   1/1  kgvdrvvvdpfelllagasytvdtlralvdlyelqlallnnplapgietvfllpslelvfivGsDllkgl
00478601   1/1  gvdrvivdpfellladlsytaftlrhlreklpadyelhgddlllllrpslvlsleelqlalmndklapgi
00399081   1/1  vevvpfedllaglaytvdtlellreriyplnalvlvvGaDalfdfprwgdweellelvglvvvprpgydl
00477741   1/1  vvvlpfelelaglsytiftlellvellpgadlvlvvGaDflfgllrwgdyelllelgnllvferpgy...
00508661   1/1  p.gdi.paevRlemvelaienp.yfpvdrvelarlglpsytagtleallhaiprknlGathfivGrD.la
00374521   1/1  vv..............................fiigadalfalllvdlikkl.gadvlvvgsdpglg...
00484991   1/1  vvlpfe..........dtlvdllkklg.ad.vlvvGldalfdferwgdiaellkllelgv..........
00465691   1/1  ldnvivlpfe....dlsytidalvilkglvpdleiefivggdnlrfgkkwggtvellpll..........
00500451   1/1  daypRllmldlaileylgvdnvvfapspiemypagpsetllga.lrrgnf.gvk.lfivgrDhaglgdff
00448691   1/1  vvvpfe......dltvdllkklgady......lvvGldalfdfdywydieellkllallvetvp......
00439971   1/1  vvvdfe......dltvdllkklgpdv......lvrgldalfdfeywlqlalllrllllivvvrvgrepdg
00458881   1/1  ivldfe......dltidllkkl......nadvlvvGld......fwfdfeyeldlallvvllrpgievv.
00480461   1/1  lgavdlvi................idtfdlllallgafrfvlvigvdtlvalvvgrdfrfgldregdvql
00485441   1/1  vvlpfe..........dtlvdllkklg.ad.vlvvGldalfdleregdialllelllegievvvvprtgd
00482161   1/1  ..rvvdlvvlp...sltvlsdtleelieelllgadvlvvGadalfglerwgdlallkelglevevvprpg
00475861   1/1  levRlemleallegylppdrvvvslleldmryagpteallhalirknygc.thlivGrDhagvgdfygpy
00360941   1/1  kyvdlvvvvpfedltvdllkelgad......vlvvgldalfgferegdl.....................
00469401   1/1  dl.paypRlemdeallenygvdlvflpllplemyyagpreavlhg.iiRknh..gvttlivGrD.hallg


                         +         -         -         -         -         *         -:210
query           LLKRKEEFDREYCTNIVYLDLLNIEISSTLIRERVRESLEVKFFLPPGVVDIIDKYNLYRRE--------
00484521   1/1  arpgdwknlvleellelvglvvvprpgydledllllldllllllagiillldlplldiSST---------
00478601   1/1  etvfelvlvvGaDflfglvrpgvwknellrellelagfvvvprpgveldglildldillkll--------
00399081   1/1  deeyelqlallnrllapdletlfllpsgiilflelplldiSSTliRellaaggsisylvp----------
00477741   1/1  .........lleivtvvllleldgldiSSTliRealaegddiselvppavaeyikehglyr---------
00508661   1/1  glgkwkdwedlydlydalvvldrpggelgieilpleelvylkkcgkivllkacphgplldiSs-------
00374521   1/1  .lrrlddfeye...villvlnrtlgiSstliRerlleggdvsylvppavleylkehglyerls-------
00484991   1/1  ..............evvflp.ltedglaiSSTliRellaeggdvselvppsvleyllekllyl-------
00465691   1/1  .........................dglgiSStliRellaeggdvsklvppavleylkekl---------
00500451   1/1  gwkdaqqllklvkdlnikivvvgrpiy....vreldglalssrniylldeer..lei-------------
00448691   1/1  ................lllllrtlgiSStliRerlleggdvsklvppavadylkekgl------------
00439971   1/1  l.......................aiSStliRellllggdvsklvppavleyllekgl------------
00458881   1/1  ...............vlpldldglaiSStliRellalggdisklvppavleylke.glg-----------
00480461   1/1  lrllrkl.............lgievvflp.levdglaiSStliRell-----------------------
00485441   1/1  gla..........................iSStliRellaeggdvselvppavleyl-------------
00482161   1/1  ldg.........................lgiSStliRerllegdled-----------------------
00475861   1/1  daqvlldkwkgleel..gieivvfrravy.............ckkcgkmaslktcphglded--------
00360941   1/1  ..............gifllliptlgiSstlirerl-----------------------------------
00469401   1/1  ivspdrayfgpkdaqqiidrmvedlnidiliigvpvyvrecdglalssrnphldedll------------