[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cper0:BAB81882.1


[Show Plain Result]

## Summary of Sequence Search
   1::378
  50::346  3.4e-96 45.9% 0051379 00513791 1/1   lo-dependent hydrolases                 
  50::346  1.3e-95 46.8% 0049957 00499571 1/1   lo-dependent hydrolases                 
  50::346  5.4e-88 44.9% 0048480 00484801 1/1   lo-dependent hydrolases                 
  50::346    2e-64 38.0% 0048612 00486121 1/1   lo-dependent hydrolases                 
   1::376  2.9e-20 43.2% 0037043 00370431 1/1   site domain of metallo-dependent hydrol 
   1::378  6.1e-20 41.5% 0041948 00419481 1/1   site domain of metallo-dependent hydrol 
   1::377  1.4e-17 42.0% 0047005 00470051 1/1   site domain of metallo-dependent hydrol 
   1::376  1.9e-17 48.8% 0044456 00444561 1/1   site domain of metallo-dependent hydrol 
   1::377  4.1e-15 44.0% 0047004 00470041 1/1   site domain of metallo-dependent hydrol 
   1::377    4e-14 42.3% 0053092 00530921 1/1   site domain of metallo-dependent hydrol 
   1::377  4.6e-14 44.9% 0047518 00475181 1/1   site domain of metallo-dependent hydrol 
  49::347  1.8e-13 17.9% 0047785 00477851 1/1   lo-dependent hydrolases                 
   1::57   1.5e-06 36.8% 0040031 00400311 1/2   site domain of metallo-dependent hydrol 
 309::377  3.6e-06 29.4% 0041367 00413671 1/1   site domain of metallo-dependent hydrol 
  50::346  8.9e-06 25.4% 0053093 00530931 1/1   lo-dependent hydrolases                 
   3::49    0.0002 46.8% 0051378 00513781 1/2   site domain of metallo-dependent hydrol 
  18::87   0.00046 37.7% 0045709 00457091 1/2   lo-dependent hydrolases                 
  18::57   0.00059 46.2% 0047865 00478651 1/2   lo-dependent hydrolases                 
   1::49     0.001 36.7% 0040833 00408331 1/1   site domain of metallo-dependent hydrol 
  49::109   0.0013 20.0% 0052760 00527601 1/2   lo-dependent hydrolases                 
 317::358   0.0052 34.1% 0047865 00478652 2/2   lo-dependent hydrolases                 
  50::88     0.032 29.0% 0048115 00481151 1/2   lo-dependent hydrolases                 
 317::354     0.04 32.4% 0045709 00457092 2/2   lo-dependent hydrolases                 
 302::347     0.12 20.9% 0052760 00527602 2/2   lo-dependent hydrolases                 
 322::346     0.19 29.2% 0048115 00481152 2/2   lo-dependent hydrolases                 
 286::376      3.5 30.4% 0040031 00400312 2/2   site domain of metallo-dependent hydrol 
 348::378      8.3 32.3% 0051378 00513782 2/2   site domain of metallo-dependent hydrol 
   1::378


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLIKNCNIVYLDKIEKGNILIENGKIKAINPKEECDCEVIDGEGLFLSPGFIDVHIHGAGGHDTMDGTYE
00513791   1/1  -------------------------------------------------GfiDlhvHGgggvdfndaeln
00499571   1/1  -------------------------------------------------GfiDlHvHGgggvdfndgsve
00484801   1/1  -------------------------------------------------GfiDlHvHggggvdfndad..
00486121   1/1  -------------------------------------------------GlIDlHvHlyggggedgfda.
00370431   1/1  mkisrlayadllgpttgdlvrladtdllaevekdltlygeelvfgggkvlrdgmglsvaaademadllik
00419481   1/1  vaaleesmllllkngrvvdpgvlvkadvliadgkIaaigsnipadllpgaevidasGklvlP........
00470051   1/1  mmdllikngrvvdpdgllvadvliedgkIaaigedlsapeaaevidasgllvlP................
00444561   1/1  mdlliknarivtpdgviedgdvliedgkIaaigeglllllaaaevidaegllvlP...............
00470041   1/1  dllikngtvvdpdgllvadvliedgkIaaigenleapegaeviDatGllvlPGl................
00530921   1/1  mfdllikngtvvdg...lvadiaikdgkIaaigslleasaaevidasGlllvlPG...............
00475181   1/1  ldlliknalvltldddlledgdvlieggrIaavg..klpaaevidasgklvmP.................
00477851   1/1  ------------------------------------------------PGlIDtHvHlrepll.glefke
00400311   1/2  grlliknakivdgdgsfladvliedGlikaigenlllPaglevidakgklvlliavg-------------
00413671   1/1  ----------------------------------------------------------------------
00530931   1/1  -------------------------------------------------GlIDtHvHl......iepfle
00513781   1/2  --lyAltnariftgdevledhavliedgkIkaivplaelpagaevidlg---------------------
00457091   1/2  -----------------tdflknPKvelhlhldgslspetllelaiengiilplgtlee.laevidasgk
00478651   1/2  -----------------tdiknlPKvelhlhldgslspetllelaikngiilplgtl-------------
00408331   1/1  llikngtvvdgtgglllaadvliedgrIvavgdllalsaaevidasGll---------------------
00527601   1/2  ------------------------------------------------PGliDsHvHlrepflgle.lke
00478652   2/2  ----------------------------------------------------------------------
00481151   1/2  -------------------------------------------------GfIDlHvHl.pgqvlkedfat
00457092   2/2  ----------------------------------------------------------------------
00527602   2/2  ----------------------------------------------------------------------
00481152   2/2  ----------------------------------------------------------------------
00400312   2/2  ----------------------------------------------------------------------
00513782   2/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           AINEISKVIVKHGTTSFLPTTMTVAAEDVCKSMEAIHKAKTEGTDGANVLGAHLEGPFISTSAIGAQNPD
00513791   1/1  lslegletlaeallaaGvtsllptlitdslevllkalkalaealeeg..gagilGlhleGPflspakkGa
00499571   1/1  gletllrallraGvttvlptlitdslevllkaleaiaealaagvsillgaailGlhleGPflspakkgah
00484801   1/1  .letvlrallaaGvttvlptlgtdsierllealkaiaealeagp.gafilGihlegPflsplkkgahppd
00486121   1/1  .etletglrallraGvttvvdtlgtagvtrnledllakaralkeeg.....ilgvhleGpyglpaktgag
00370431   1/1  narivdgdgivkadiaikdGrIaaigkalepplldgvdlivgsateviDaeGkivtPG............
00419481   1/1  ......................................................................
00470051   1/1  ......................................................................
00444561   1/1  ......................................................................
00470041   1/1  ......................................................................
00530921   1/1  ......................................................................
00475181   1/1  ......................................................................
00477851   1/1  dlesgtraaaagGvttvvdmpntvppittlealeayleraeeaapvnvgplggltllegenleelaelak
00400311   1/2  ----------------------------------------------------------------------
00413671   1/1  ----------------------------------------------------------------------
00530931   1/1  tleevleaalaaGVttvvdag.gtglenfeamlelaekyplrvlaflnisvvglhpldflgdgdeltlee
00513781   1/2  ----------------------------------------------------------------------
00457091   1/2  lvlpgfidahthldqvl-----------------------------------------------------
00478651   1/2  ----------------------------------------------------------------------
00408331   1/1  ----------------------------------------------------------------------
00527601   1/2  dlesgtraaaagGvttvvdmpntlppidtleallaller-------------------------------
00478652   2/2  ----------------------------------------------------------------------
00481151   1/2  .......aalagGvTtvv----------------------------------------------------
00457092   2/2  ----------------------------------------------------------------------
00527602   2/2  ----------------------------------------------------------------------
00481152   2/2  ----------------------------------------------------------------------
00400312   2/2  ----------------------------------------------------------------------
00513782   2/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           FLIPPTKENFYKLVGEHEDDVVSITLAPEVEGAKELTKFLSEKGIVVSMGHTKATYEEAMEGIKCGCSHA
00513791   1/1  hppelirdpdlellkllldaagg.iklvtlaPeldg.lelidllvelgivvslGhsnatyeqalaaleag
00499571   1/1  ppelirepdieeldllleaagdliklvtlapelegalelikelvelgivvslGHsnatyeealaaleaGa
00484801   1/1  lirgpdidlldll....asviklvtlapelaga.elikllvklgivvslghsnatleealealeagatvi
00486121   1/1  sllddlrlidevigvkaaisdirasllgvvtlapevegarvaallaketgvlhvhlghsdagleevleal
00370431   1/1  ......................................................................
00419481   1/1  ......................................................................
00470051   1/1  ......................................................................
00444561   1/1  ......................................................................
00470041   1/1  ......................................................................
00530921   1/1  ......................................................................
00475181   1/1  ......................................................................
00477851   1/1  eaGaiglklymtdsglgvvddellrealelaaelglpvlvhaededliellleglanegifdsvlhlfsr
00400311   1/2  ----------------------------------------------------------------------
00413671   1/1  ----------------------------------------------------------------------
00530931   1/1  laelikvvaigeiGLklfmdysavieaqkevleaalelakelkdlpvvvHvrdapedlleilelleegdi
00513781   1/2  ----------------------------------------------------------------------
00457091   1/2  ----------------------------------------------------------------------
00478651   1/2  ----------------------------------------------------------------------
00408331   1/1  ----------------------------------------------------------------------
00527601   1/2  ----------------------------------------------------------------------
00478652   2/2  ----------------------------------------------------------------------
00481151   1/2  ----------------------------------------------------------------------
00457092   2/2  ----------------------------------------------------------------------
00527602   2/2  ----------------------------------------------------------------------
00481152   2/2  ----------------------------------------------------------------------
00400312   2/2  ----------------------------------------------------------------------
00513782   2/2  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           THLFNAMTPFTHREPGVVGAVFDSEITTETISDGIHIAYPSLRVAYKQKGTDKVLLITDAMMACCMPDGM
00513791   1/1  atlitHlfnampglhhrepglvgaalllddlyagliaDgiHvhpaalrlalrakg.dglvlvtDAmaaag
00499571   1/1  dvitHlfnamsglhhrepgvvgaallldelyveliadgiHvhpallrlalrakgpdrlvlvtDamaaagl
00484801   1/1  tHlfnampglhhrepglvgaallldrlyagliadgihvhpaalklalkakglerlvlvtDamaaaglpdg
00486121   1/1  eegailvthlyp.mhi..hrepglvgaalealdrgvyvdliaghdgvhvspealklaleaglgpdritls
00370431   1/1  ......................................................................
00419481   1/1  ......................................................................
00470051   1/1  ......................................................................
00444561   1/1  ......................................................................
00470041   1/1  ......................................................................
00530921   1/1  ......................................................................
00475181   1/1  ......................................................................
00477851   1/1  paeaeaeaidrale.laretglplhithistaealelireakaegllvtaevtphhllltredlldggll
00400311   1/2  ----------------------------------------------------------------------
00413671   1/1  ----------------------------------------------------------------------
00530931   1/1  viHcfhgsaagilvaeeatllelalealelGv......yidiggg.......................st
00513781   1/2  ----------------------------------------------------------------------
00457091   1/2  ----------------------------------------------------------------------
00478651   1/2  ----------------------------------------------------------------------
00408331   1/1  ----------------------------------------------------------------------
00527601   1/2  ----------------------------------------------------------------------
00478652   2/2  ----------------------------------------------------------------------
00481151   1/2  ----------------------------------------------------------------------
00457092   2/2  ----------------------------------------------------------------------
00527602   2/2  ----------------------------------------------------------------------
00481152   2/2  ----------------------------------------------------------------------
00400312   2/2  ----------------------------------------------------------------------
00513782   2/2  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           YSLGGQDVEVKNGAARLLSGSLAGSILTLDVAVKNIFKNTNYPLNEVIKMATYNGAKHCKVDDKKGLIKE
00513791   1/1  lpdgvyllgglevlvkdglarladgtlaGsvltlleavrnlvkllglsleealrmatlnPAkllgl----
00499571   1/1  pdgeyllgglkvlvedgvarladgtlaGstltlldavrnlvellglslaealrmaTlnpArllgld----
00484801   1/1  vyalgglpvlvedgvlrlaggtlaGsvltllealrnlvkllglsleealrmaTlnPArllgldd.k----
00486121   1/1  tDa............lgglpvlvedgvlv...gtlagslltlldavlnlvkllglsleealrmatl----
00370431   1/1  ......................................................................
00419481   1/1  ......................................................................
00470051   1/1  ......................................................................
00444561   1/1  ......................................................................
00470041   1/1  ......................................................................
00530921   1/1  ......................................................................
00475181   1/1  .....................................................................G
00477851   1/1  lgtlakclPplrlseedrealwkaladgvidaigsDhaphtleekelglgdflkapaG.ipgletal---
00400311   1/2  ----------------------------------------------------------------------
00413671   1/1  ----------------------------ldiiiknGtivtadgisradellkdgeltlveaalitrsnta
00530931   1/1  fknakalrealk.igldrllleTDapyltp..........................rnepvysllv----
00513781   1/2  ----------------------------------------------------------------------
00457091   1/2  ----------------------------------------------------------------------
00478651   1/2  ----------------------------------------------------------------------
00408331   1/1  ----------------------------------------------------------------------
00527601   1/2  ----------------------------------------------------------------------
00478652   2/2  ------------------------------------allfglspee.lkaatlnaaralglddeigslev
00481151   1/2  ----------------------------------------------------------------------
00457092   2/2  ------------------------------------allfglspee.lkaatlnsakalglddeigslll
00527602   2/2  ---------------------ipgletalpllltllvregllsleeavellslnpakilglppnkGs---
00481152   2/2  -----------------------------------------lsleeavrlltsnpAkilgl.pdrG----
00400312   2/2  -----grlliknakivdgdgsfladvliedGlikaigenlllP............aglevidakgklvll
00513782   2/2  -------------------------------------------------------------------iek


                         -         -         -         -         *         -         -:420
query           GYDADLILFDDNIDIKYVIVNGKLVHKA------------------------------------------
00513791   1/1  ----------------------------------------------------------------------
00499571   1/1  ----------------------------------------------------------------------
00484801   1/1  ----------------------------------------------------------------------
00486121   1/1  ----------------------------------------------------------------------
00370431   1/1  ..........................--------------------------------------------
00419481   1/1  ........GliepgkdADlvlldpdllv------------------------------------------
00470051   1/1  gslavGadADlvlvdpdalltvdaetl-------------------------------------------
00444561   1/1  .GsievGkdADlvlldldllvlltiv--------------------------------------------
00470041   1/1  ......ADlvvvdpdalltisaellls-------------------------------------------
00530921   1/1  .flevGkdaDltifdldpellllkdgv-------------------------------------------
00475181   1/1  sleeGklADlvlldldaphllplhnll-------------------------------------------
00477851   1/1  ----------------------------------------------------------------------
00400311   1/2  ----------------------------------------------------------------------
00413671   1/1  ellglrd.rGhlavGavAdlvlydlda-------------------------------------------
00530931   1/1  ----------------------------------------------------------------------
00513781   1/2  ----------------------------------------------------------------------
00457091   1/2  ----------------------------------------------------------------------
00478651   1/2  ----------------------------------------------------------------------
00408331   1/1  ----------------------------------------------------------------------
00527601   1/2  ----------------------------------------------------------------------
00478652   2/2  gkladlll--------------------------------------------------------------
00481151   1/2  ----------------------------------------------------------------------
00457092   2/2  gkla------------------------------------------------------------------
00527602   2/2  ----------------------------------------------------------------------
00481152   2/2  ----------------------------------------------------------------------
00400312   2/2  iavgsdadlvivdpeeevtisadtlh--------------------------------------------
00513782   2/2  gkianltvfdrdfkvlktvvngeevlte------------------------------------------