[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cper0:BAB81914.1


[Show Plain Result]

## Summary of Sequence Search
   1::535
   4::275 2.8e-127 65.8% 0044700 00447001 1/1   p containing nucleoside triphosphate hy 
   3::270 1.1e-122 67.3% 0043468 00434681 1/1   p containing nucleoside triphosphate hy 
 291::535  1.4e-86 49.2% 0049298 00492981 1/1    I glutamine amidotransferase-like      
 291::535  1.3e-75 40.0% 0050138 00501381 1/1    I glutamine amidotransferase-like      
 255::537  2.6e-57 36.1% 0045752 00457521 1/1    I glutamine amidotransferase-like      
 286::535  1.2e-53 35.1% 0047949 00479491 1/1    I glutamine amidotransferase-like      
 296::537  1.9e-52 40.5% 0038211 00382111 1/1    I glutamine amidotransferase-like      
 300::531  7.3e-47 32.8% 0042722 00427221 1/1    I glutamine amidotransferase-like      
 300::534  4.4e-45 35.9% 0047286 00472861 1/1    I glutamine amidotransferase-like      
 300::534  7.1e-45 33.9% 0047324 00473241 1/1    I glutamine amidotransferase-like      
 302::533  2.5e-42 32.3% 0050645 00506451 1/1    I glutamine amidotransferase-like      
 311::517  2.6e-40 31.2% 0047771 00477711 1/1    I glutamine amidotransferase-like      
 301::528  1.5e-39 30.7% 0039782 00397821 1/1    I glutamine amidotransferase-like      
 293::537  2.4e-39 34.0% 0043181 00431811 1/1    I glutamine amidotransferase-like      
 300::535  6.2e-39 30.7% 0051730 00517301 1/1    I glutamine amidotransferase-like      
 291::531  6.2e-38 35.1% 0048482 00484821 1/1    I glutamine amidotransferase-like      
 301::534    7e-38 34.4% 0039988 00399881 1/1    I glutamine amidotransferase-like      
 292::528  2.1e-35 31.1% 0042648 00426481 1/1    I glutamine amidotransferase-like      
 278::513  3.7e-34 28.9% 0046884 00468841 1/1    I glutamine amidotransferase-like      
 329::524  6.7e-16 18.5% 0051742 00517421 1/1    I glutamine amidotransferase-like      
 295::533  1.8e-15 25.2% 0052900 00529001 1/1    I glutamine amidotransferase-like      
 272::388  6.4e-12 23.0% 0041867 00418671 1/1    I glutamine amidotransferase-like      
 294::388  1.2e-11 36.8% 0037903 00379031 1/1    I glutamine amidotransferase-like      
 293::388  3.5e-09 30.2% 0042074 00420741 1/1    I glutamine amidotransferase-like      
   1::428  1.5e-08 21.2% 0035779 00357791 1/1   p containing nucleoside triphosphate hy 
   3::177  2.7e-08 25.6% 0049073 00490731 1/1   p containing nucleoside triphosphate hy 
 341::528  8.2e-07 24.6% 0049527 00495271 1/1    I glutamine amidotransferase-like      
 291::388  2.2e-06 27.8% 0048285 00482851 1/1    I glutamine amidotransferase-like      
 292::388  1.9e-05 26.1% 0042273 00422731 1/1    I glutamine amidotransferase-like      
   6::428  0.00034 20.7% 0038794 00387941 1/1   p containing nucleoside triphosphate hy 
   1::535


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSKNTKYVFVTGGVVSSLGKGITAASLGRLLKNRGLSVSIQKFDPYLNIDPGTMSPYQHGEVFVTDDGAE
00447001   1/1  ---ltkyifvtgGvvsslgkGivaaslglllksrglkvtllkldPylnvdpGtlsPlehGevfvtddGae
00434681   1/1  --kllkyifvtgGvvsslGkgitaaslglllksrglkvtllkldPylnvdpGtlsPlehGevfvtddGae
00492981   1/1  ----------------------------------------------------------------------
00501381   1/1  ----------------------------------------------------------------------
00457521   1/1  ----------------------------------------------------------------------
00479491   1/1  ----------------------------------------------------------------------
00382111   1/1  ----------------------------------------------------------------------
00427221   1/1  ----------------------------------------------------------------------
00472861   1/1  ----------------------------------------------------------------------
00473241   1/1  ----------------------------------------------------------------------
00506451   1/1  ----------------------------------------------------------------------
00477711   1/1  ----------------------------------------------------------------------
00397821   1/1  ----------------------------------------------------------------------
00431811   1/1  ----------------------------------------------------------------------
00517301   1/1  ----------------------------------------------------------------------
00484821   1/1  ----------------------------------------------------------------------
00399881   1/1  ----------------------------------------------------------------------
00426481   1/1  ----------------------------------------------------------------------
00468841   1/1  ----------------------------------------------------------------------
00517421   1/1  ----------------------------------------------------------------------
00529001   1/1  ----------------------------------------------------------------------
00418671   1/1  ----------------------------------------------------------------------
00379031   1/1  ----------------------------------------------------------------------
00420741   1/1  ----------------------------------------------------------------------
00357791   1/1  M....kaifitgt.dtgvGKTtvsaaLaralarrglrvavfK.............Pvqtglds..tdggl
00490731   1/1  --dvslsvkkgkvialvG..kgGvGKTTlaaklagllakrggkvllidaDp...................
00495271   1/1  ----------------------------------------------------------------------
00482851   1/1  ----------------------------------------------------------------------
00422731   1/1  ----------------------------------------------------------------------
00387941   1/1  -----mkviavtsgkgGvGKTtlaanLaaalaerGkkVllidaDpqgpslslllglegeplgladllage


                         -         -         *         -         -         -         -:140
query           TDLDLGHYERFIDENLTQNSNVTSGRVYWSVISKERKGEYLGGTVQVIPHITNAIKDRVHRVGKERDVDV
00447001   1/1  tDldlGhyerfldvelskdnnittGkiylevlekerrGdylgktvqviPhitdeikdlillvaesleldv
00434681   1/1  tdldlGhyerfldvklsrannittGkiyleviekerrGdylGktvqviPhitdeiksrillva..egldv
00492981   1/1  ----------------------------------------------------------------------
00501381   1/1  ----------------------------------------------------------------------
00457521   1/1  ----------------------------------------------------------------------
00479491   1/1  ----------------------------------------------------------------------
00382111   1/1  ----------------------------------------------------------------------
00427221   1/1  ----------------------------------------------------------------------
00472861   1/1  ----------------------------------------------------------------------
00473241   1/1  ----------------------------------------------------------------------
00506451   1/1  ----------------------------------------------------------------------
00477711   1/1  ----------------------------------------------------------------------
00397821   1/1  ----------------------------------------------------------------------
00431811   1/1  ----------------------------------------------------------------------
00517301   1/1  ----------------------------------------------------------------------
00484821   1/1  ----------------------------------------------------------------------
00399881   1/1  ----------------------------------------------------------------------
00426481   1/1  ----------------------------------------------------------------------
00468841   1/1  ----------------------------------------------------------------------
00517421   1/1  ----------------------------------------------------------------------
00529001   1/1  ----------------------------------------------------------------------
00418671   1/1  ----------------------------------------------------------------------
00379031   1/1  ----------------------------------------------------------------------
00420741   1/1  ----------------------------------------------------------------------
00357791   1/1  edgdalllqalaglllpled..vnpvllkepasphlaanldgvlid.....lelilealarlakdadvvl
00490731   1/1  ..yrpaadellgvlaee.........................lgldvl.lgarggdlsgglrqrlarall
00495271   1/1  ----------------------------------------------------------------------
00482851   1/1  ----------------------------------------------------------------------
00422731   1/1  ----------------------------------------------------------------------
00387941   1/1  adledailetp...egldllpaglllaglellrger................................lr


                         +         -         -         -         -         *         -:210
query           VITEIGGTIGDIESLPFLEAIRQIKYDVGKENVCFIHVTLVPYLGKAGELKTKPTQHSVKELRSIGIQPD
00447001   1/1  viveiGGtvGdieslpflealrqlrlelgrenvllvhvtlvpylkaagelktkPtqhsvkelrslGiqpd
00434681   1/1  vivEiGGtvgdieslpflealrqlrlelgrenvllvhvtlvpllkaagelktkPtqhsvkelrslGiqpd
00492981   1/1  ----------------------------------------------------------------------
00501381   1/1  ----------------------------------------------------------------------
00457521   1/1  ----------------------------------------------------------------------
00479491   1/1  ----------------------------------------------------------------------
00382111   1/1  ----------------------------------------------------------------------
00427221   1/1  ----------------------------------------------------------------------
00472861   1/1  ----------------------------------------------------------------------
00473241   1/1  ----------------------------------------------------------------------
00506451   1/1  ----------------------------------------------------------------------
00477711   1/1  ----------------------------------------------------------------------
00397821   1/1  ----------------------------------------------------------------------
00431811   1/1  ----------------------------------------------------------------------
00517301   1/1  ----------------------------------------------------------------------
00484821   1/1  ----------------------------------------------------------------------
00399881   1/1  ----------------------------------------------------------------------
00426481   1/1  ----------------------------------------------------------------------
00468841   1/1  ----------------------------------------------------------------------
00517421   1/1  ----------------------------------------------------------------------
00529001   1/1  ----------------------------------------------------------------------
00418671   1/1  ----------------------------------------------------------------------
00379031   1/1  ----------------------------------------------------------------------
00420741   1/1  ----------------------------------------------------------------------
00357791   1/1  vEGagglavpllrdlsnadlarlldlp...........................................
00490731   1/1  .gdydvliiDtpgtldvllelallellkellaelgad---------------------------------
00495271   1/1  ----------------------------------------------------------------------
00482851   1/1  ----------------------------------------------------------------------
00422731   1/1  ----------------------------------------------------------------------
00387941   1/1  elleel..addyDvviiDtppglgdltllalaaa....................................


                         -         -         -         +         -         -         -:280
query           IIVCRSEKELSEDIKKKIGLFCNIDASEVIQNLDAEHLYAVPLMLHKEGLDRLVCEKLGLGCRDIDNAEW
00447001   1/1  llvlrsekpldeelkeklalfcnveleavislldvesiyevPllleeqgldelilellglellep-----
00434681   1/1  llvlrsekpldeelkeklalfcnveeeavislldvdsiyevPllleeqgldelilellgl----------
00492981   1/1  ----------------------------------------------------------------------
00501381   1/1  ----------------------------------------------------------------------
00457521   1/1  --------------------------------------------leglgllelvlvlllldlleldlvaw
00479491   1/1  ----------------------------------------------------------------------
00382111   1/1  ----------------------------------------------------------------------
00427221   1/1  ----------------------------------------------------------------------
00472861   1/1  ----------------------------------------------------------------------
00473241   1/1  ----------------------------------------------------------------------
00506451   1/1  ----------------------------------------------------------------------
00477711   1/1  ----------------------------------------------------------------------
00397821   1/1  ----------------------------------------------------------------------
00431811   1/1  ----------------------------------------------------------------------
00517301   1/1  ----------------------------------------------------------------------
00484821   1/1  ----------------------------------------------------------------------
00399881   1/1  ----------------------------------------------------------------------
00426481   1/1  ----------------------------------------------------------------------
00468841   1/1  -------------------------------------------------------------------mkk
00517421   1/1  ----------------------------------------------------------------------
00529001   1/1  ----------------------------------------------------------------------
00418671   1/1  -------------------------------------------------------------alllskrls
00379031   1/1  ----------------------------------------------------------------------
00420741   1/1  ----------------------------------------------------------------------
00357791   1/1  ......................................................................
00490731   1/1  ----------------------------------------------------------------------
00495271   1/1  ----------------------------------------------------------------------
00482851   1/1  ----------------------------------------------------------------------
00422731   1/1  ----------------------------------------------------------------------
00387941   1/1  ......................................................................


                         -         *         -         -         -         -         +:350
query           IDMVHRITHLTHTTKIALVGKYVELHDAYISVVEALNHGGLSNDTNVEIEWINAEDVTKENVDELLSGVD
00447001   1/1  ----------------------------------------------------------------------
00434681   1/1  ----------------------------------------------------------------------
00492981   1/1  ----------kkevkiavvgdygsltgnllsilealehagaevvvkveilwvpsdl.leeeilellkgad
00501381   1/1  ----------mgkpvigilgkyillldaydsvtaalylagrllgvgvevvvvgadvltleeipellddad
00457521   1/1  vsllelllnpggevriavid.y....gsfynilralrelga..evevvpvdidaeeleal.......dpd
00479491   1/1  -----agkpvigvlpglvprilvldy.gsgnlyrsiaralreaGa....evvvvpvd...ltleeipell
00382111   1/1  ---------------ialvgkkilildfggsftenlvralrelgvevevvpvdadlleil.....lldpd
00427221   1/1  -------------------mkkiliidfgdsflynlvralrelgvevvvvpvdaltle....eilllnpd
00472861   1/1  -------------------mk.vllldygdsfteslaralrelgaevevvpvdlelletld.eidlldpd
00473241   1/1  -------------------mk.ilvldfygsnteslvralrelgaevevvpvdleletlpeell.lldpd
00506451   1/1  ---------------------mkilvldfggsnleslaralrelgaevevvpvd...ldleeil..llda
00477711   1/1  ------------------------------kiivivdpgsgnlrdiaralrelgve.vevvrdpedleda
00397821   1/1  --------------------gallkvivivdygsgnlrdlaralrelgvevevvpid.........edil
00431811   1/1  ------------kmkiavl....dfggnytsllralreag......aevvvvsp........dedledad
00517301   1/1  -------------------mlkiliidfgdsftgsivralrelgvevevvpnda......dleelle.pd
00484821   1/1  ----------mmkmkilvl....dlpgsgnlqsiaralreag......vevvvvpaddltld..eilled
00399881   1/1  --------------------mkilvidlggsnleslvdalrelgaevevvrvdvld......eedledad
00426481   1/1  -----------lkaldgvkiavl....dfggnytsllralrelg......aevvvvssled........l
00468841   1/1  llliggfrgdlslleplldllelltgdkpkigvipyagldldfegyyrsvldalerlG......aevvvv
00517421   1/1  ------------------------------------------------aevligvlildggvgnhisvla
00529001   1/1  --------------senifvmsedralrqdirplrIllLnlmpkkidtevqflrllgaqpl....qvelt
00418671   1/1  llllllllkllaskkilvllfdgfedlelvgpldalrrag....aevvvvspdgglpvvgshgllvvtad
00379031   1/1  -------------kkilvllfdgfellelasplralreag......aevevvspdggpvtssnglallad
00420741   1/1  ------------mkkvlvllagggvldgfellEavlpldaLrragaevtvaspdggqvhvvnhllgeleg
00357791   1/1  ......................................................................
00490731   1/1  ----------------------------------------------------------------------
00495271   1/1  ------------------------------------------------------------agrvllddfd
00482851   1/1  ----------esklplpdlaednalfpsllslskllsslllleglllplllllmkkvlvvltsagvlmkk
00422731   1/1  -----------mmkkvlvllfdgfellelvgpldvlrrag....yevtvvspdgglpvtsslgltvlpda
00387941   1/1  ......................................................................


                         -         -         -         -         *         -         -:420
query           GVLVPGGFGDRGVEGKIEAIRWARENKKPFLGICLGMQCAVIEYARNVLGLEGAHSSELNPETPFPVIDL
00447001   1/1  ----------------------------------------------------------------------
00434681   1/1  ----------------------------------------------------------------------
00492981   1/1  gillpGGpgdpgveglieairealengiPvLGIClGmQllavalggnvlglkdahsgefseetnhpvlgl
00501381   1/1  glvlpGGpgspddlglleairealergkpvlGIClGmQllaealggkveklpgaelglldpevtrnvvgl
00457521   1/1  glilpGGpgdprrleglieairealeagkPvlGIClGhQllaealggkvvrlkvghsge...........
00479491   1/1  ddadglilpGGpsdvddlgalrrdegllelirealergdlkPvlGIClGmQlLaealgg.........kv
00382111   1/1  glilpGGpgsprdeglielirealeagkPvlGiClGmQllalalggkvlkl.......kvpelglnsvvl
00427221   1/1  glilpGGpgspydardegllelirealeagkPilGIClGhQllalalggkvlkl................
00472861   1/1  glilpGGpgsvgdeglieairealeagvpvLGiClGhQllaealggkvlr....................
00473241   1/1  glilpGGpgspdllglleairealeagvpvLGiClGhQllaealggkvlr....................
00506451   1/1  dglilpGGp.svgdaglleairealealgkpvlGiClGmqllaealggkvvrlkvpeh............
00477711   1/1  dgiilpGgfstrgdlrllrlsglieairealergiPvLGIClGmQlLaealggpv...............
00397821   1/1  lldadglilPGggstvddlrllrleglieairealeagkPvLGIClGmQlLaealggp............
00431811   1/1  glilpGGpgtvyalllrdeglleaireaaeagkpvlGiClGmqlLaealggkvvkglgllpgkvvteyrg
00517301   1/1  giilsGGpgspadeglllialiklalelgiPiLGiClGhQllalalggkvvklkvge.............
00484821   1/1  adglilpGGpgdpldlgalprieglielirealeagkpvlGIClGhQlLaealggkverlpeg.......
00399881   1/1  alilPGggspadalrllrleglieaireaaesgkpvlGIClGmqlLaealggkvg...............
00426481   1/1  egadglilpGGfstvdllllrnsglleaireaaeagkPvlGiClGlqlLaealggpg.............
00468841   1/1  slle......dpleaLpdaDglilpGGntfalldllretglleaireavengkpvlGiCaGmqllg.esi
00517421   1/1  alerlgvevvvvrkped.lkdidglilPGggsttiallallariglllalikfviakgkpvlGiClGmQl
00529001   1/1  llridshlskntaalhltrfyetfdlidlekfDgliitGgpvsvldfedvpwleelkellkwalenkkpt
00418671   1/1  ttlddvdledyDalvlPGGfgaddlradeelleliref--------------------------------
00379031   1/1  ltldev..dledyDalilpGGpgtvdllrdpgllelir--------------------------------
00420741   1/1  enrnvvvesagialvadltladvdladyDalvlPGGfg--------------------------------
00357791   1/1  .vilVvdiglgsinaalltleallqrglrlagvvlnrvrgdrhllaellealeellgipvlgvlpylpdl
00490731   1/1  ----------------------------------------------------------------------
00495271   1/1  glvlpGGfsygdvlgggaiaaasllmndklelallkffarrgkpvLGiCnGfQlLv..elgllpggdlld
00482851   1/1  vlillfdgfellElagpldvLrragyevdlaspdggpv--------------------------------
00422731   1/1  tlddldp.ledyDalvlpGgfgaaddlrddpallellr--------------------------------
00387941   1/1  .............dgvllVvdpellalraarrllellrklglpllgvvlNkvdprar.........eell


                         -         -         +         -         -         -         -:490
query           MPEQKDVEDLGGTMRLGLYPCKLEDNTFCKDVYASDLIYERHRHRYEFNNEYRTQLIESGLTIAGTSPDG
00447001   1/1  ----------------------------------------------------------------------
00434681   1/1  ----------------------------------------------------------------------
00492981   1/1  lpglvlrnallelvdslsdlggtmrlGwhpvvlvegsllfkgygkgliivrhrHsyavdplylplleeeg
00501381   1/1  leesfvlvellgvphlgwnpvalaegsllfkglgeeliverhrhryevhsdavdrllpeglevlatspdg
00457521   1/1  ..........................nsplfkglggdviivyhsHgyavn....leslpeglevlatsln
00479491   1/1  ikgpggeegvvvpvellgl..llvstlflg.lpspllkgsllapia.......ygvhsyevneihgdave
00382111   1/1  vldgglfeglpgtlrlyfyhs................livrhshgdavne......lpeglvvlatsddg
00427221   1/1  ..............kvgelgwnsvvltlvtdgsllfkglg.delivyfyHsyavde......lpeglevl
00472861   1/1  ..........lktgrlgwnsvvltegsplfkglg.dvlivyfsHsyavte......lpeglevlats.dg
00473241   1/1  ..........lktgelgwnsvvltegsplfkglg.dvlivyfsHgyavde......lpeglevlats.dg
00506451   1/1  ..................gwvsviltdgsplfkglgde.ltvyfsHsyav......delpeglevlatse
00477711   1/1  ...gleglgllgggvlllgtlrlphmgwnllelplllgigegvygyevhsyrtlpnglavlaltedg...
00397821   1/1  ...gsvpglgllpgkvvrnkegrlvvphlgwnvvvl.dsplfkglgeelrvyeiHsyavevndetlellp
00431811   1/1  ltlpvvgadalfvg................................levvvhgyevhsdavee.lpegle
00517301   1/1  .................lgwnsvvltlgsplfkglg.evlivyfyHsyavde......lpeglevlatsd
00484821   1/1  ......................pelgllpvevtegsplfrglgdelrvyeiHsdvtelp.........eg
00399881   1/1  vpglglld........gktvrlykgrlphvgvngplfkglpdpltvyeiHslrvev........lpdgll
00426481   1/1  ...vpglgllpgkver......lalgrtvlslvgdlllpglgwnlrgyeihadlveglpegaevlavhdg
00468841   1/1  ldpgglegaeggevpglgllpgvvvrhadgrqvdsfggeprmgrlnevlirgphilgigidegtalyfvh
00517421   1/1  Laeasgepg.........vleglgeigglgllditvvrnafgrqphsgwndlkikglsplfkgilnksif
00529001   1/1  LGiClGaqllayalggkvkkal.............................pgkefGvfpvtltddgdpl
00418671   1/1  ----------------------------------------------------------------------
00379031   1/1  ----------------------------------------------------------------------
00420741   1/1  ----------------------------------------------------------------------
00357791   1/1  alperhll--------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00495271   1/1  ................paltrnasgrfesrwvtlrvenspsiflsgl.agsvlpvpvaHg.egvfeladd
00482851   1/1  ----------------------------------------------------------------------
00422731   1/1  ----------------------------------------------------------------------
00387941   1/1  eelaeelg--------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           RLVECVEVKDHPWFVAVQYHPELKSRPNRPHPLFVGFVGAALNNK-------------------------
00447001   1/1  ----------------------------------------------------------------------
00434681   1/1  ----------------------------------------------------------------------
00492981   1/1  lvvtatspdgglveaielkdhpfvlgvQfHPElsstpldglplfk-------------------------
00501381   1/1  ngsllglieaiehkdgpvflGvqfHPErsltplgglrlfrnflea-------------------------
00457521   1/1  dglveaiehkdgpvf.gvqfHPEfslgplglrllfdnfleaalglkg-----------------------
00479491   1/1  elpeglvvlatspdg.sveaiegidhkdgnvlGvQfHPEftsgpl-------------------------
00382111   1/1  .lveaiehkdlpvf.gvQfHPEstsgplg.lrlfrnfleaalglkkd-----------------------
00427221   1/1  atslddglveaiehkdlpvf.gvQfHPEsslgplg.lallk-----------------------------
00472861   1/1  t.ieaielkdgp.vlgvqfHPElsltplgl.rlfrnfleaalgl--------------------------
00473241   1/1  t.ieaielkdgpvf.gvqfHPElsltplg.lrlfrnfleaagak--------------------------
00506451   1/1  dgs.ieaielkdgpvl.gvqfHPEftsgplg.lrllrnfleaa---------------------------
00477711   1/1  .........viagaavrdgnvlGvqfH-------------------------------------------
00397821   1/1  egllvlattedgg..viagaavekgnvlgvqfHPEk..--------------------------------
00431811   1/1  vlatsddg..ieaie...hgnvlgvqfHpefts.glrllrnflelir-----------------------
00517301   1/1  dgp.veairhkdlpif.gvQfHPEvtstplg.lrllknFlelale-------------------------
00484821   1/1  levlatsedgs.ieairhkd...vlgvqfHPEfdsdd..gl-----------------------------
00399881   1/1  vlars.dgl.iegiehkdgnvl.GvqfHPefs..seaglrllkn--------------------------
00426481   1/1  .............agaavrkgnvlgvqfHpelsgdp.r--------------------------------
00468841   1/1  sylvvvgnvlgtqf.........-----------------------------------------------
00517421   1/1  yfvhsyiraplied........vgvtvavlsygg------------------------------------
00529001   1/1  lrglpdeftvphsrytehhdd..vielppglellassencg.v---------------------------
00418671   1/1  ----------------------------------------------------------------------
00379031   1/1  ----------------------------------------------------------------------
00420741   1/1  ----------------------------------------------------------------------
00357791   1/1  ----------------------------------------------------------------------
00490731   1/1  ----------------------------------------------------------------------
00495271   1/1  lvlaaleedgqvalrYvdndgnpteeyPlNPnGslngi--------------------------------
00482851   1/1  ----------------------------------------------------------------------
00422731   1/1  ----------------------------------------------------------------------
00387941   1/1  ----------------------------------------------------------------------