[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cper0:BAB82028.1


[Show Plain Result]

## Summary of Sequence Search
   1::643
 240::532  9.6e-84 38.8% 0041634 00416341 1/1    II aaRS and biotin synthetases         
 239::538  1.6e-82 33.7% 0046638 00466381 1/1    II aaRS and biotin synthetases         
 216::554  1.3e-77 35.4% 0049378 00493781 1/1    II aaRS and biotin synthetases         
 228::538  6.8e-67 34.5% 0047165 00471651 1/1    II aaRS and biotin synthetases         
 236::538  6.4e-66 35.5% 0041422 00414221 1/1    II aaRS and biotin synthetases         
  63::238  4.1e-62 50.6% 0042737 00427371 1/1   /AlaRS common domain                    
  61::239  6.2e-61 45.3% 0041633 00416331 1/1   /AlaRS common domain                    
 234::538    8e-60 32.1% 0041426 00414261 1/1    II aaRS and biotin synthetases         
 230::550  4.9e-55 27.0% 0035194 00351941 1/1    II aaRS and biotin synthetases         
 226::550  2.2e-51 30.1% 0035382 00353821 1/1    II aaRS and biotin synthetases         
 259::547  1.8e-48 27.0% 0051519 00515191 1/1    II aaRS and biotin synthetases         
 255::564  1.4e-47 26.7% 0048934 00489341 1/1    II aaRS and biotin synthetases         
 256::540  2.9e-47 27.9% 0050706 00507061 1/1    II aaRS and biotin synthetases         
 254::507  1.2e-42 26.1% 0040152 00401521 1/1    II aaRS and biotin synthetases         
  65::224  4.4e-42 40.8% 0044651 00446511 1/1   /AlaRS common domain                    
 254::540  2.2e-39 23.9% 0035005 00350051 1/1    II aaRS and biotin synthetases         
 267::545  3.2e-38 26.4% 0049994 00499941 1/1    II aaRS and biotin synthetases         
 535::640  4.8e-32 42.5% 0041420 00414201 1/1    II aaRS ABD-related                    
 535::640  2.3e-31 43.8% 0038521 00385211 1/1    II aaRS ABD-related                    
 539::640  2.8e-31 44.1% 0037214 00372141 1/1    II aaRS ABD-related                    
 535::641  6.2e-31 42.5% 0041424 00414241 1/1    II aaRS ABD-related                    
 533::644    7e-31 44.6% 0041631 00416311 1/1    II aaRS ABD-related                    
 542::640    9e-29 41.4% 0035193 00351931 1/1    II aaRS ABD-related                    
 542::634  1.9e-28 50.0% 0042728 00427281 1/1    II aaRS ABD-related                    
 543::639    3e-27 45.4% 0050705 00507051 1/1    II aaRS ABD-related                    
 543::639  1.7e-23 30.2% 0035004 00350041 1/1    II aaRS ABD-related                    
 543::634  4.4e-23 32.6% 0040151 00401511 1/1    II aaRS ABD-related                    
 534::639  1.7e-22 31.1% 0037946 00379461 1/1    II aaRS ABD-related                    
 534::644    7e-21 27.0% 0052834 00528341 1/1    II aaRS ABD-related                    
 277::536  2.3e-18 27.6% 0037947 00379471 1/1    II aaRS and biotin synthetases         
 254::505    2e-17 18.8% 0042520 00425201 1/1    II aaRS and biotin synthetases         
 545::645  3.5e-15 29.7% 0044672 00446721 1/1    II aaRS ABD-related                    
   2::62   8.8e-15 45.9% 0048938 00489381 1/1   ike                                     
   2::60   8.6e-12 40.7% 0048468 00484681 1/1   ike                                     
 255::564  6.4e-07 18.0% 0048394 00483941 1/1    II aaRS and biotin synthetases         
 264::505  8.5e-07 23.0% 0046922 00469221 1/1    II aaRS and biotin synthetases         
 259::423  1.1e-06 20.7% 0042525 00425251 1/1    II aaRS and biotin synthetases         
 264::412  2.2e-05 20.6% 0046052 00460521 1/1    II aaRS and biotin synthetases         
 260::500  3.5e-05 18.5% 0046437 00464371 1/1    II aaRS and biotin synthetases         
   1::643


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MIKITLKDGSIKEVEAGLSIFEIAQSISQGLARNACCGILNGKVEDLRFIVNEDSSLEICTFDSKEGQHA
00416341   1/1  ----------------------------------------------------------------------
00466381   1/1  ----------------------------------------------------------------------
00493781   1/1  ----------------------------------------------------------------------
00471651   1/1  ----------------------------------------------------------------------
00414221   1/1  ----------------------------------------------------------------------
00427371   1/1  --------------------------------------------------------------ddrrglli
00416331   1/1  ------------------------------------------------------------vdwdrrgllm
00414261   1/1  ----------------------------------------------------------------------
00351941   1/1  ----------------------------------------------------------------------
00353821   1/1  ----------------------------------------------------------------------
00515191   1/1  ----------------------------------------------------------------------
00489341   1/1  ----------------------------------------------------------------------
00507061   1/1  ----------------------------------------------------------------------
00401521   1/1  ----------------------------------------------------------------------
00446511   1/1  ----------------------------------------------------------------rrlllm
00350051   1/1  ----------------------------------------------------------------------
00499941   1/1  ----------------------------------------------------------------------
00414201   1/1  ----------------------------------------------------------------------
00385211   1/1  ----------------------------------------------------------------------
00372141   1/1  ----------------------------------------------------------------------
00414241   1/1  ----------------------------------------------------------------------
00416311   1/1  ----------------------------------------------------------------------
00351931   1/1  ----------------------------------------------------------------------
00427281   1/1  ----------------------------------------------------------------------
00507051   1/1  ----------------------------------------------------------------------
00350041   1/1  ----------------------------------------------------------------------
00401511   1/1  ----------------------------------------------------------------------
00379461   1/1  ----------------------------------------------------------------------
00528341   1/1  ----------------------------------------------------------------------
00379471   1/1  ----------------------------------------------------------------------
00425201   1/1  ----------------------------------------------------------------------
00446721   1/1  ----------------------------------------------------------------------
00489381   1/1  -ilvtlPdGsvkelpagvtpldvAysistglakkavaakvngelvdlstplenddeleiltf--------
00484681   1/1  -iyvtlPdGsvlelpagvtpldvAysistglakkavaakvngelvdlstplenddtveil----------
00483941   1/1  ----------------------------------------------------------------------
00469221   1/1  ----------------------------------------------------------------------
00425251   1/1  ----------------------------------------------------------------------
00460521   1/1  ----------------------------------------------------------------------
00464371   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           FNHTASHVLAAAVKRLFPQDKLAIGPSIDNGFYYDFDTEKPFSADQLNKLEEEMKKIIKENPEIKRFELP
00416341   1/1  ----------------------------------------------------------------------
00466381   1/1  ----------------------------------------------------------------------
00493781   1/1  ----------------------------------------------------------------------
00471651   1/1  ----------------------------------------------------------------------
00414221   1/1  ----------------------------------------------------------------------
00427371   1/1  lrhsaahlLaaalkellgehvlqigslvedgfyyDfsldkplteeelekieklmnelikenlpierlevs
00416331   1/1  lrHsathlLaaalrkllgdaklqigslvedgfyyDfsldeklteeelekieklvneiikenlpverlevs
00414261   1/1  ----------------------------------------------------------------------
00351941   1/1  ----------------------------------------------------------------------
00353821   1/1  ----------------------------------------------------------------------
00515191   1/1  ----------------------------------------------------------------------
00489341   1/1  ----------------------------------------------------------------------
00507061   1/1  ----------------------------------------------------------------------
00401521   1/1  ----------------------------------------------------------------------
00446511   1/1  rlHtatHlLaaalrkllgehlvlqigsligedglrfDfslpgklteeeleeieklvneiikenlpvevle
00350051   1/1  ----------------------------------------------------------------------
00499941   1/1  ----------------------------------------------------------------------
00414201   1/1  ----------------------------------------------------------------------
00385211   1/1  ----------------------------------------------------------------------
00372141   1/1  ----------------------------------------------------------------------
00414241   1/1  ----------------------------------------------------------------------
00416311   1/1  ----------------------------------------------------------------------
00351931   1/1  ----------------------------------------------------------------------
00427281   1/1  ----------------------------------------------------------------------
00507051   1/1  ----------------------------------------------------------------------
00350041   1/1  ----------------------------------------------------------------------
00401511   1/1  ----------------------------------------------------------------------
00379461   1/1  ----------------------------------------------------------------------
00528341   1/1  ----------------------------------------------------------------------
00379471   1/1  ----------------------------------------------------------------------
00425201   1/1  ----------------------------------------------------------------------
00446721   1/1  ----------------------------------------------------------------------
00489381   1/1  ----------------------------------------------------------------------
00484681   1/1  ----------------------------------------------------------------------
00483941   1/1  ----------------------------------------------------------------------
00469221   1/1  ----------------------------------------------------------------------
00425251   1/1  ----------------------------------------------------------------------
00460521   1/1  ----------------------------------------------------------------------
00464371   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           RNEALELMKDEPYKVELINDLPEGEVISFYQIGDFVDLCAGPHLMAVKPIKAVKLLRSTGAYWKGDEKNK
00416341   1/1  ----------------------------------------------------------------------
00466381   1/1  ----------------------------------------------------------------------
00493781   1/1  ----------------------------------------------------------------------
00471651   1/1  ----------------------------------------------------------------------
00414221   1/1  ----------------------------------------------------------------------
00427371   1/1  leealelfalfgekykvelieelvedgdevrvyrigdfvdlcggthvpntgeigafkllsvsgaywlgds
00416331   1/1  leealelfalepyklaligekyegdevrvvrigdfvdlcgGthvpntgeigafkilsesgaywrgdsgnr
00414261   1/1  ----------------------------------------------------------------------
00351941   1/1  ----------------------------------------------------------------------
00353821   1/1  ----------------------------------------------------------------------
00515191   1/1  ----------------------------------------------------------------------
00489341   1/1  ----------------------------------------------------------------------
00507061   1/1  ----------------------------------------------------------------------
00401521   1/1  ----------------------------------------------------------------------
00446511   1/1  lsreealeifgalayklelipd..egeevrvvrigdfdvelcgGthvpnTgeigafkilsvsgaygkg..
00350051   1/1  ----------------------------------------------------------------------
00499941   1/1  ----------------------------------------------------------------------
00414201   1/1  ----------------------------------------------------------------------
00385211   1/1  ----------------------------------------------------------------------
00372141   1/1  ----------------------------------------------------------------------
00414241   1/1  ----------------------------------------------------------------------
00416311   1/1  ----------------------------------------------------------------------
00351931   1/1  ----------------------------------------------------------------------
00427281   1/1  ----------------------------------------------------------------------
00507051   1/1  ----------------------------------------------------------------------
00350041   1/1  ----------------------------------------------------------------------
00401511   1/1  ----------------------------------------------------------------------
00379461   1/1  ----------------------------------------------------------------------
00528341   1/1  ----------------------------------------------------------------------
00379471   1/1  ----------------------------------------------------------------------
00425201   1/1  ----------------------------------------------------------------------
00446721   1/1  ----------------------------------------------------------------------
00489381   1/1  ----------------------------------------------------------------------
00484681   1/1  ----------------------------------------------------------------------
00483941   1/1  ----------------------------------------------------------------------
00469221   1/1  ----------------------------------------------------------------------
00425251   1/1  ----------------------------------------------------------------------
00460521   1/1  ----------------------------------------------------------------------
00464371   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           MLSRVYGTAFPKKSELDAYLEALEEAKKRDHNKLGRELGIFTTDENVGQGLPLLMPKGARIIQTLQRWIE
00416341   1/1  -----------------------------dhrelgkrlglidfereagsGlydllPlgarlrrklenfir
00466381   1/1  ----------------------------kdhvelgkrlglfdiyggvk.Glydllplgarlrraleniir
00493781   1/1  -----vgtefdnvellkvglkrledaekrdhvelgkrlglidesaekvsgsGlyvllplgarllralenf
00471651   1/1  -----------------kvlkpleedferdhvelgkrlglidfqg..vsGfydllplgarlrralenfir
00414221   1/1  -------------------------dakrdhrelglrlglidf.rlsgsGfyvllplgarlrralenfir
00427371   1/1  knkglqRiygvagpdakelkeylkrlee------------------------------------------
00416331   1/1  rlqriyGtaaldklelkeylklleeakkr-----------------------------------------
00414261   1/1  -----------------------eedaeldhvelllrlglldl.rlsvsGlydllPlgarlrraieniir
00351941   1/1  -------------------ltlkeealvalhkrrgfllrafeiygg.lsGlydylPlglrlknkleniwr
00353821   1/1  ---------------ltlkleplvellkrrglllr.....ageiygggsGlydylPlglrllnkleniwr
00515191   1/1  ------------------------------------------------yllPkGlrdllplglrlrskie
00489341   1/1  --------------------------------------------irqlvsGlydllplglrlrrkienii
00507061   1/1  ---------------------------------------------gmirqlpsGlydwlplglrlrrkie
00401521   1/1  -------------------------------------------irqlpkGtrdylplglrlrrkieeiir
00446511   1/1  ....lrRiyavagp--------------------------------------------------------
00350051   1/1  -------------------------------------------iiqlpkgtrdllpaglrlrrkieniir
00499941   1/1  --------------------------------------------------------lglrlrskied.ir
00414201   1/1  ----------------------------------------------------------------------
00385211   1/1  ----------------------------------------------------------------------
00372141   1/1  ----------------------------------------------------------------------
00414241   1/1  ----------------------------------------------------------------------
00416311   1/1  ----------------------------------------------------------------------
00351931   1/1  ----------------------------------------------------------------------
00427281   1/1  ----------------------------------------------------------------------
00507051   1/1  ----------------------------------------------------------------------
00350041   1/1  ----------------------------------------------------------------------
00401511   1/1  ----------------------------------------------------------------------
00379461   1/1  ----------------------------------------------------------------------
00528341   1/1  ----------------------------------------------------------------------
00379471   1/1  ------------------------------------------------------------------eklv
00425201   1/1  -------------------------------------------kidvllgrrdllpgglhprskvieair
00446721   1/1  ----------------------------------------------------------------------
00489381   1/1  ----------------------------------------------------------------------
00484681   1/1  ----------------------------------------------------------------------
00483941   1/1  --------------------------------------------nrldlgtndllpl.lrlrskiesair
00469221   1/1  -----------------------------------------------------tlpllldlellpldkkl
00425251   1/1  ------------------------------------------------RiyGydnipvtlp..lhplqkl
00460521   1/1  -----------------------------------------------------llPlpikklvslelrlr
00464371   1/1  -------------------------------------------------slelrlryryldlgrrdllpa


                         -         *         -         -         -         -         +:350
query           DEEQRRGYVLTKTPLMAKSDLYKISGHWDHYKDGMFVLGDEEKDSEVFALRPMTCPFQYAIYNSTQHSYR
00416341   1/1  eelvklgyqevltPilvpaelleksghldkfgeemfkltk.dregrdlyLrPtaepgitrlfadellsyr
00466381   1/1  evlvrygyqevltPilepaellkasghldgfgdemykf.drggrd..laLrPtsevpiarlfaneilsyr
00493781   1/1  ireelvelgylevltPilvpaelleasghldkfgdelfkveded.....lyLrPTaeviltnlfrdeils
00471651   1/1  evlleygylevltPileptellwkesghledfgdemykftdrggrdleeplyLrPtsevgitrlfanlil
00414221   1/1  eell.lgyqevltPllvpaellwkesghlegfgdelfkvtklgkdregddlyLrPtsevpitrlfadeil
00427371   1/1  ----------------------------------------------------------------------
00416331   1/1  ----------------------------------------------------------------------
00414261   1/1  eeldelgylevltPilvpaellekesghlegfgdelfrvtdrggnalgrelaLrptselpltrlfrdeil
00351941   1/1  eefvllregylevdtPillpaelwkaSghldkfgdelyklkdrggrfradhlleelleklleellldlel
00353821   1/1  eelvllregylevdtPillpaelwkaSghldifgdelyklkdrkglseprefnlmfetllgPtheevltl
00515191   1/1  niireffdkrGflevetPilepaelllrwegaghl.lvgkelftftdr..ggrelaLrpeltpq...lar
00489341   1/1  reffeerGflevetPilepaelleesaghlldkfakelftvtdr..ggrelaLrpelTaevarlllknll
00507061   1/1  diireffderGflevetPilepaellkesggedifge.mftftdr..ggrelaLrPettpqlarkl..ll
00401521   1/1  evfrryGyqevltPilepaelllrsagghwdiygkemyrfkdr..ggrelaLrpdltppiarlfa.ells
00446511   1/1  ----------------------------------------------------------------------
00350051   1/1  evferyGylevetPilepaelllgslggrldhygkemfrlkdr..ggrelaLrpdltppvarllaqnlls
00499941   1/1  evfdrygflevetPilepaellgas.........dfldrs....grelaLrpdltpp....larlllmsy
00414201   1/1  ----------------------------------------------------------------------
00385211   1/1  ----------------------------------------------------------------------
00372141   1/1  ----------------------------------------------------------------------
00414241   1/1  ----------------------------------------------------------------------
00416311   1/1  ----------------------------------------------------------------------
00351931   1/1  ----------------------------------------------------------------------
00427281   1/1  ----------------------------------------------------------------------
00507051   1/1  ----------------------------------------------------------------------
00350041   1/1  ----------------------------------------------------------------------
00401511   1/1  ----------------------------------------------------------------------
00379461   1/1  ----------------------------------------------------------------------
00528341   1/1  ----------------------------------------------------------------------
00379471   1/1  ellkrrgfvfpseesleiseiygGlswdyGPlgveLknnlkelWwksfvllredvvgldslhlevlkasg
00425201   1/1  eiflslgflevetPilesaesnfdallfpvdhpardlqdtfylggavakelytfkdyfgrd..llLrtht
00446721   1/1  ----------------------------------------------------------------------
00489381   1/1  ----------------------------------------------------------------------
00484681   1/1  ----------------------------------------------------------------------
00483941   1/1  effdeygflev.tPlilepaedllflrgggarld....gkel....drlgrdlyLrpspelylkrllagg
00469221   1/1  vslelrlryryldgrrdllpailrvrskieraireffdergflevetPi.....Ltkssgeg..agkelf
00425251   1/1  lrrlreilaglGftEvitfsllslelahparlmq...dtvyllnP..lseersvLRtsllpgllralayn
00460521   1/1  yryldgrrdllpailrvrskiesaireffdergflevetPilepaell.......gagkelftfkd..rg
00464371   1/1  ilrlrskiisaireffeergflevetPi.....Ltkssgeg..vakelftfsdrf.grdlyLrpspelyl


                         -         -         -         -         *         -         -:420
query           DLPVRFAETSTLFRNESSGEMHGLIRVRQFTLADGHIVCTPEQLEDEFKNTVDLVKYVMETLGIADDITY
00416341   1/1  dlPlrlyqigtvfRnEasgrgrGLlRvreFtqvdahifgdpeqaeeeleelldlyleilkrlgl.pyrvl
00466381   1/1  dlPlrlyqigpvFRnEarprlrGllRvreFtqveaeifgtpeqaldelaellalaleilerlgl.pyrvv
00493781   1/1  yrdlPlrlaqigtcfRnEassaGrplrGLlRvreFtqveahiFvdpdleqaleeleelldlyeeilerlg
00471651   1/1  syrdlPlrlyqigpvfRnEaspr..gLlRvreFtqveaheifgtpeqaadeleelldlaleilerlglep
00414221   1/1  syrdlPlrlyqigtvfRnEarp.trgllRvreFtsqveahifhvtpedadeeleelldlyeeilkrlgl.
00427371   1/1  ----------------------------------------------------------------------
00416331   1/1  ----------------------------------------------------------------------
00414261   1/1  syrdlPlrlyqigpvFRnEgrptr.gLlRvreFtqmkvehffhadpedaeeeleelldlyeeileelglp
00351941   1/1  kkeleslllellglsleelkelieeydikcPlcgekgdlteprpFnlmfdtllgPtaeevltlylrpeta
00353821   1/1  llrpetaqgifvnfknllllsykklPlrlaqigkkFRnEirP.rnGLlRvreFtqkeaesFvlpedalet
00515191   1/1  lllrsgrdlPlrlyqigpvFRdErp....glgRlreFtqldaeifgadsedadae...vedllleilkel
00489341   1/1  vsgrdlPlrlyqigpvFRnErprag....RvreFtqleaeifgadsedadae...vldllleilkelgl.
00507061   1/1  rsgrdlPlrlyqigpvFRnErpg..ag..RlrEFtqldaeifgadeedadae..vldllleilkrlglpd
00401521   1/1  yrdlplrlyyigpvFRdErp....glgrlreftqldaeifgadseda..daevlallleilkrlgleddv
00446511   1/1  ----------------------------------------------------------------------
00350051   1/1  ykelplrlyyigpvFRdErp....glgrlreftqvdaeifgadseda..daeliallleilkrlgl.kdv
00499941   1/1  rdlplrlyqigpvfRdErpg......rvref.qldaeifg.eddlaadae.viallleilkelgl.kdlt
00414201   1/1  ----------------------------------------------------------------------
00385211   1/1  ----------------------------------------------------------------------
00372141   1/1  ----------------------------------------------------------------------
00414241   1/1  ----------------------------------------------------------------------
00416311   1/1  ----------------------------------------------------------------------
00351931   1/1  ----------------------------------------------------------------------
00427281   1/1  ----------------------------------------------------------------------
00507051   1/1  ----------------------------------------------------------------------
00350041   1/1  ----------------------------------------------------------------------
00401511   1/1  ----------------------------------------------------------------------
00379461   1/1  ----------------------------------------------------------------------
00528341   1/1  ----------------------------------------------------------------------
00379471   1/1  hvradhlvcpetlgellteprlfnlmfktligplldssgylrpetaqgifvnfknllelarkklPfgiaq
00425201   1/1  tlvlarllasllk.....PlrvfeigpvFRaErsdathl....peFhqlegevagadlslaeliglleel
00446721   1/1  ----------------------------------------------------------------------
00489381   1/1  ----------------------------------------------------------------------
00484681   1/1  ----------------------------------------------------------------------
00483941   1/1  lg........kvyqigpvFRdErpqsg.rlrhlpEFtqldaemaga..dledlmaeleallaellkailg
00469221   1/1  rfkd..rggrelaLrpspelylkrllaagld........rvyqigpvFRdErprtg....RhrEFtqlda
00425251   1/1  lnrglklPirlfeigrvfrnd..eplvlaghlrgfhqleglv.vdkd...vdfadlkglleallealgl.
00460521   1/1  grdlaLrpspelylarllaggld........rvyqigpvFRdErprtg....rlrEFtqlda--------
00464371   1/1  krllaggld........rvyqigpvFRdErp....garrlrEFtqldaemaga..dyedlmaeleallrd


                         -         -         +         -         -         -         -:490
query           RFSKWDPNNTEKYINDPEAWENTQNIMREILNHLNIDFTEADDEAAFYGPKLDIQFKNVHGKEDTIITIQ
00416341   1/1  rlstgdiggsakytgdievwlpaenglreilscsnldyfqlrglaafygpkldvllkdalgrtlqgstfq
00466381   1/1  rlntgd....lgfagdlefwlpaeaglreilsalncddfqalglnalygldidfelkdelvrtlngttla
00493781   1/1  lp....yrvvlltsg..elgagasktyd............................leawfpldgaliev
00471651   1/1  yrvvlntrgdlg.....................................ayagpkidfevllplgryiel
00414221   1/1  pyrvvrlstgdl...................................gegasygydieawlpd..gryie
00427371   1/1  ----------------------------------------------------------------------
00416331   1/1  ----------------------------------------------------------------------
00414261   1/1  .yrvvrldsge...................................lgggasytydieallpd..grgie
00351941   1/1  qgifvnfknllllsykklPlrlaqigkkFRnEirP.rnGLlRvReFtqkeaesFvlpedaletyeymlal
00353821   1/1  yeymlaaylrilkklglpyrvlrl....................................revladegah
00515191   1/1  gl.kyvvvrlsdrgalg..glle...vlgdarealielldklglalliellelglfvgplliallkdvld
00489341   1/1  pyvvvelgtgdile..eflalydvledalrallealdlani.....eglgafylkkldikvedalgllat
00507061   1/1  fvrlrlntrp....ilglgsdefdleagealiealdklglaanievld.alygpklldelldaldelvgl
00401521   1/1  tlklnhrglleavlaylgllgdllsrlfdvldklgedrleknllrildfkrggyaevlekaealldplla
00446511   1/1  ----------------------------------------------------------------------
00350051   1/1  rlelnslgi..lealleylglllsaefallealdeddivrleavplgildekaegllellellgagslle
00499941   1/1  lklnhrgll..dallg..gldkpdlrallealdkldlldldsvlgllanplplldlkggdalgldrlapl
00414201   1/1  ----------------------------------------------------------------------
00385211   1/1  ----------------------------------------------------------------------
00372141   1/1  ----------------------------------------------------------------------
00414241   1/1  ----------------------------------------------------------------------
00416311   1/1  ----------------------------------------------------------------------
00351931   1/1  ----------------------------------------------------------------------
00427281   1/1  ----------------------------------------------------------------------
00507051   1/1  ----------------------------------------------------------------------
00350041   1/1  ----------------------------------------------------------------------
00401511   1/1  ----------------------------------------------------------------------
00379461   1/1  ----------------------------------------------------------------------
00528341   1/1  ----------------------------------------------------------------------
00379471   1/1  iGkcFRseagneisprgliRvreftkvElevFvdPedseeeleyflalaeeflekLglpyrv.lrfrd.h
00425201   1/1  lkelf..................................gelvevrlrppyfpftepsfevfvygyelgd
00446721   1/1  ----------------------------------------------------------------------
00489381   1/1  ----------------------------------------------------------------------
00484681   1/1  ----------------------------------------------------------------------
00483941   1/1  llgleleifgritlsealeflg................................................
00469221   1/1  emag..adyedldaeleallkellkailg...........idlglpfirityrealeilledkpdllfdl
00425251   1/1  .ev-------------------------------------------------------------------
00460521   1/1  ----------------------------------------------------------------------
00464371   1/1  llkal..lgdlklel.....nglgidllrplerlgliekllkvlgaldkldrlgleeaiellrelglkve


                         *         -         -         -         -         +         -:560
query           IDFALAERFGMYYIDKDGEKKRPYIIHRSSIGCYERTLAMLIEKYAGALPTWIAPVQAKVLPLSDKYADY
00416341   1/1  ldrklperlelnyqdedgkikrPvvlhrgiyGsveRliaali----------------------------
00466381   1/1  ldrlllailelnyqgedgslviPvvlhpalvggleryigilfEayagl----------------------
00493781   1/1  gscsnl.gdfq.arrldiryldedgkkelphtlngsglG.veRllaallenyqdedglvllPpa------
00471651   1/1  gtisnlgdyqarrldiryldedgk...pvlvhtnglglgeRllaalle----------------------
00414221   1/1  vgtisqlgdylaerlgiryldedgk...pvilhhtlnGsglRllaall----------------------
00427371   1/1  ----------------------------------------------------------------------
00416331   1/1  ----------------------------------------------------------------------
00414261   1/1  vgtisqlgdfqaerfdiryldedgk...pvhvlngsygigeRllaall----------------------
00351941   1/1  ylrilkklglppenlrfrlv...ladelahyasdswdf..........evlfpfgldelv----------
00353821   1/1  ygsksidfevlfpagedelvgcsnrtdydlrehalgsgedlvtilllaelkevltleyvl----------
00515191   1/1  rpllvleqaplilldfllperfellvaglellnvgypvlidpslvrgleyytgivfe-------------
00489341   1/1  lntildaldfellerlel.yvdgleaagvpvlldpalvrgldyytgivfelyakalealgle....aava
00507061   1/1  ptflldfplplsplaevlerfelvlaglelaggspelidpslqrgleyyt--------------------
00401521   1/1  ealeeleallealealg-----------------------------------------------------
00446511   1/1  ----------------------------------------------------------------------
00350051   1/1  klleealgrleqlleylkalgvpvrldlslvrgldyytgvvFellargig--------------------
00499941   1/1  ltdqldfealerlealleylgalgikl.pvvidlalvrgldyytgivfeiyaggl---------------
00414201   1/1  --------------------------------------------yglvlPpwlAPvqvvviplglkdsee
00385211   1/1  --------------------------------------------yglvlPpwlAPvqvvvipislkdsee
00372141   1/1  ------------------------------------------------fPpwlaPvqvvvvpigeelley
00414241   1/1  --------------------------------------------yglvlPpwlAPvqvvvipislkdsle
00416311   1/1  ------------------------------------------ddyglvlPpwlaPvqvvvvplgdeelle
00351931   1/1  ---------------------------------------------------wlAPvqvvviplllkdeel
00427281   1/1  ---------------------------------------------------wlaPvqvvviplgeealey
00507051   1/1  ----------------------------------------------------laPvqvvvvplgeealey
00350041   1/1  ----------------------------------------------------lapvdvyvvplgeealey
00401511   1/1  ----------------------------------------------------lapvdvyvvplgeealey
00379461   1/1  -------------------------------------------rvvlklppalaPvkvavlplglkkeel
00528341   1/1  -------------------------------------------rtvlilppalAPikvailplslkkeel
00379471   1/1  lahyAaktyDlevwfp..ggwrEivgcsnrtdydlrrhskgsglkl------------------------
00425201   1/1  wfevlgcglllpevl-------------------------------------------------------
00446721   1/1  ------------------------------------------------------lgnvstePvqcvvipv
00489381   1/1  ----------------------------------------------------------------------
00484681   1/1  ----------------------------------------------------------------------
00483941   1/1  ...............................................lldelveellelfepvfvtdypl
00469221   1/1  e............ld-------------------------------------------------------
00425251   1/1  ----------------------------------------------------------------------
00460521   1/1  ----------------------------------------------------------------------
00464371   1/1  vakelg.all------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           ANEVVEELRRRGVRVEADHRAEKIGYKIREARLERTPYILVVGEKEAENKEVSVRSRKNGEEGAMPLADF
00416341   1/1  ----------------------------------------------------------------------
00466381   1/1  ----------------------------------------------------------------------
00493781   1/1  ----------------------------------------------------------------------
00471651   1/1  ----------------------------------------------------------------------
00414221   1/1  ----------------------------------------------------------------------
00427371   1/1  ----------------------------------------------------------------------
00416331   1/1  ----------------------------------------------------------------------
00414261   1/1  ----------------------------------------------------------------------
00351941   1/1  ----------------------------------------------------------------------
00353821   1/1  ----------------------------------------------------------------------
00515191   1/1  ----------------------------------------------------------------------
00489341   1/1  dggr------------------------------------------------------------------
00507061   1/1  ----------------------------------------------------------------------
00401521   1/1  ----------------------------------------------------------------------
00446511   1/1  ----------------------------------------------------------------------
00350051   1/1  ----------------------------------------------------------------------
00499941   1/1  ----------------------------------------------------------------------
00414201   1/1  elleyaeelakeLraagirvllddrneslgkkfrdadligipyrlvvGdkeledgtvtvrrrdtgeqvtv
00385211   1/1  elleyaeelakeLraagirvllddrdelsigkkirdadligvPyrlvvGdkeledgtvtvrrrdt.eqet
00372141   1/1  alelakeLraagirvelddrneslgkkirdadligipyvlvvGdkelengtvtvrrrdtgeqvtvsldel
00414241   1/1  elleyaeelakeLra.girvllddrnesigkkirdaeligiPlrivvGdkeledgtvtvrrrdtgeqvrv
00416311   1/1  yalelaeeLraagirvelddrgeslgkkirdadligipyvlvvGekelengtvtvrdrdtgeqvtvslde
00351931   1/1  leyaeklaaeLraagirvllddrdesigkkfrradligvpfrivvGekeleegedaaeeedgtvtvrdrd
00427281   1/1  alklaeelrdagirveldlrgeklgkkikdadligipyvlvvGekelengtvtvknrdtgeqetvsldel
00507051   1/1  alelaeeLraagirveldlrgeklgkklkeadligapyalviGekelengtvtvkdrdtgeqetvsldel
00350041   1/1  alklaekLrd.girveldlsgeklkkqlkradklgapfaviiGedelesgtvtlkdldtgeqvtvsldel
00401511   1/1  alklaeeLraalpgirvelddsgrslgkqlkradkigapfaviiGedeledgtvtlkdldtgeqvtvpld
00379461   1/1  lelalelyneLreagisvlydykedsdgsigkryaradeigipfavtigedelengtvtvrdrdtgeqer
00528341   1/1  lelaeelyneLrkagisvllddleddsgsigkryaradeigipfritigedtlengtvtlrdrdtmeqer
00379471   1/1  ----------------------------------------------------------------------
00425201   1/1  ----------------------------------------------------------------------
00446721   1/1  nkeqleYaesvgrrLrelGlrvdllflneevslgkaledvksqgvpyaivvgeeeqilssctvnvlhgap
00489381   1/1  ----------------------------------------------------------------------
00484681   1/1  ----------------------------------------------------------------------
00483941   1/1  afya------------------------------------------------------------------
00469221   1/1  ----------------------------------------------------------------------
00425251   1/1  ----------------------------------------------------------------------
00460521   1/1  ----------------------------------------------------------------------
00464371   1/1  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           VNRIVLEIANREN---------------------------------------------------------
00416341   1/1  ----------------------------------------------------------------------
00466381   1/1  ----------------------------------------------------------------------
00493781   1/1  ----------------------------------------------------------------------
00471651   1/1  ----------------------------------------------------------------------
00414221   1/1  ----------------------------------------------------------------------
00427371   1/1  ----------------------------------------------------------------------
00416331   1/1  ----------------------------------------------------------------------
00414261   1/1  ----------------------------------------------------------------------
00351941   1/1  ----------------------------------------------------------------------
00353821   1/1  ----------------------------------------------------------------------
00515191   1/1  ----------------------------------------------------------------------
00489341   1/1  ----------------------------------------------------------------------
00507061   1/1  ----------------------------------------------------------------------
00401521   1/1  ----------------------------------------------------------------------
00446511   1/1  ----------------------------------------------------------------------
00350051   1/1  ----------------------------------------------------------------------
00499941   1/1  ----------------------------------------------------------------------
00414201   1/1  sldelvellk------------------------------------------------------------
00385211   1/1  vsldelvell------------------------------------------------------------
00372141   1/1  vellkellee------------------------------------------------------------
00414241   1/1  sldelvellke-----------------------------------------------------------
00416311   1/1  lvellkelleeilt--------------------------------------------------------
00351931   1/1  tgeqervsld------------------------------------------------------------
00427281   1/1  vell------------------------------------------------------------------
00507051   1/1  velllelle-------------------------------------------------------------
00350041   1/1  vellkells-------------------------------------------------------------
00401511   1/1  elve------------------------------------------------------------------
00379461   1/1  vkidelvdy-------------------------------------------------------------
00528341   1/1  vsidelvdyllell--------------------------------------------------------
00379471   1/1  ----------------------------------------------------------------------
00425201   1/1  ----------------------------------------------------------------------
00446721   1/1  kehrnmpledaltlv-------------------------------------------------------
00489381   1/1  ----------------------------------------------------------------------
00484681   1/1  ----------------------------------------------------------------------
00483941   1/1  ----------------------------------------------------------------------
00469221   1/1  ----------------------------------------------------------------------
00425251   1/1  ----------------------------------------------------------------------
00460521   1/1  ----------------------------------------------------------------------
00464371   1/1  ----------------------------------------------------------------------