[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cper0:BAB82040.1


[Show Plain Result]

## Summary of Sequence Search
   1::99
   1::99     2e-31 50.5% 0049681 00496811 1/1   like                                    
   1::99


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNGVQSKLKGKDLDFLFEAILKLEDINECYNFFEDICTISELKALAQRLHVAKMLREKKTYTEIAEETKA
00496811   1/1  kellllelllskleseeldlllelllllkdeeelylllelllTpdElealaqRlevaklLlegeltqreI


                         -         -         *         -         -         -         -:140
query           STATISRVNRCLNYGADGYNNILNRLDEK-----------------------------------------
00496811   1/1  aeelgvsiAtitRvsraLkygsdgyklll-----------------------------------------