[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for cper0:BAB82333.1


[Show Plain Result]

## Summary of Sequence Search
   1::241
  82::238  1.7e-44 36.5% 0052630 00526301 1/1   smate lyase-like                        
   1::75   2.4e-20 44.0% 0050048 00500481 1/1   ed helix" DNA-binding domain            
   7::80   1.6e-18 43.2% 0047247 00472471 1/1   ed helix" DNA-binding domain            
  10::91   2.2e-10 28.4% 0043758 00437581 1/1   ed helix" DNA-binding domain            
   9::73   1.4e-08 30.8% 0037767 00377671 1/1   ed helix" DNA-binding domain            
  27::76   2.4e-08 32.0% 0039384 00393841 1/1   ed helix" DNA-binding domain            
  14::76   2.2e-06 32.3% 0045968 00459681 1/1   ed helix" DNA-binding domain            
   1::68   3.2e-05 24.6% 0042770 00427701 1/1   ed helix" DNA-binding domain            
   8::77   4.1e-05 27.1% 0040266 00402661 1/1   ed helix" DNA-binding domain            
   8::73   5.4e-05 25.0% 0045862 00458621 1/1   ed helix" DNA-binding domain            
  12::73   6.8e-05 27.6% 0045032 00450321 1/1   ed helix" DNA-binding domain            
   1::241


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MFKRSRGIALYHQLETELIDLINSGELKENDKLPSERELCEQYNVSRTTARQAIGELERKEYVYKVHGKG
00526301   1/1  ----------------------------------------------------------------------
00500481   1/1  mldllsslplyeqiaealreaIlsgelapgdrLpsereLaeelgvsrttvreAlrlLeaeglverrpgrG
00472471   1/1  ------slplyeqvaealreailsgelapgdrLPsereLaerlgvsrttvrealrrLeaeglverrpgrg
00437581   1/1  ---------elterqrlilellve.lylkeggpvsvreLaellglgvSraTirrdLaeLeelGllervhg
00377671   1/1  --------dveeRlarlLlllalrlglrlgdgllidlllteeeLAellgvsretvsraLkeLekegliel
00393841   1/1  --------------------------lleggepvsveeLaeelgvsrstvrrdlalLeelglvirrrggg
00459681   1/1  -------------lllderrlkillllle.dgrlsveeLaeelgvSrstvrrhlkrLeeaGliiesvpgk
00427701   1/1  lssalgelslsrdleqrvlellre...lgegkaltakeLakelgvskstvnraLysLereglvvregg--
00402661   1/1  -------iflllraarllikllgellkrlglsptrlriLalLaesdgpltvselaeelglskstvsralk
00458621   1/1  -------lleltelledylklillllledg..plsvseLaerlgvspptvsralkrLeedGlvererdgg
00450321   1/1  -----------kkldyalrillylal....depvsseeiAerlgvspstlrkilslLkkaglvesvrGaG


                         -         -         *         -         -         -         -:140
query           TFISPKVYKQQLLKFYSFTEEMKKLGKNPSSKILSFDLIRADNKISEKLKVEENSLVYKIVRLRIADEVP
00526301   1/1  -----------lssltsfteelraqgrkpstevlsfelvpadaevaeaLglepgdpvlrierlrladgeP
00500481   1/1  tfVae-----------------------------------------------------------------
00472471   1/1  tfVaelslde------------------------------------------------------------
00437581   1/1  gagriptlkgyrlyvdkllkv-------------------------------------------------
00377671   1/1  rrg-------------------------------------------------------------------
00393841   1/1  yrlagd----------------------------------------------------------------
00459681   1/1  gyrlll----------------------------------------------------------------
00427701   1/1  ----------------------------------------------------------------------
00402661   1/1  rLeelGl---------------------------------------------------------------
00458621   1/1  drl-------------------------------------------------------------------
00450321   1/1  gyv-------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           MMVECTYLPEYRFIDLKEKMLKEKPMYDIFREVYNVSLTKAKESFKPILISKSDSKLLNVEDGTAAMRIE
00526301   1/1  valetsylpaalfpglleedle.gslyeyLeeelglkitraeetieavladeeeaelLgippgaplllve
00500481   1/1  ----------------------------------------------------------------------
00472471   1/1  ----------------------------------------------------------------------
00437581   1/1  ----------------------------------------------------------------------
00377671   1/1  ----------------------------------------------------------------------
00393841   1/1  ----------------------------------------------------------------------
00459681   1/1  ----------------------------------------------------------------------
00427701   1/1  ----------------------------------------------------------------------
00402661   1/1  ----------------------------------------------------------------------
00458621   1/1  ----------------------------------------------------------------------
00450321   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           RVTFENERVIEYTVSVSRGDKFEYTVVLEED---------------------------------------
00526301   1/1  rvtyldadgrpveysrslyrgdrfrfvv------------------------------------------
00500481   1/1  ----------------------------------------------------------------------
00472471   1/1  ----------------------------------------------------------------------
00437581   1/1  ----------------------------------------------------------------------
00377671   1/1  ----------------------------------------------------------------------
00393841   1/1  ----------------------------------------------------------------------
00459681   1/1  ----------------------------------------------------------------------
00427701   1/1  ----------------------------------------------------------------------
00402661   1/1  ----------------------------------------------------------------------
00458621   1/1  ----------------------------------------------------------------------
00450321   1/1  ----------------------------------------------------------------------