[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for dred0:ABO48556.1


[Show Plain Result]

## Summary of Sequence Search
   1::371
   3::342  PF02463 0.0% 26.4367816091954  RecF/RecN/SMC N terminal domain 
   1::371


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRVKKLSLRNFRNYKEAQFIPHPSINIITGPNAQGKTNLLEAIYYSLRGCSFRAEKDRDVTNWESNHTVI
PF02463         --lkrleienFksyagktvilpfsksftaivGpNGSGKsnvldAilFvLGeksakklrseklsdlihksk


                         -         -         *         -         -         -         -:140
query           NTEVNLSSRLIKLQWKIQEGSKKLSLNGVERPRSELDLFGVVLFCPEDLSLIKGSPQERRHFLDYEVGTL
PF02463         skakvksaeveitfdnedkelvieeeevsitrrvkrkgeseykingkevtkkevaellesagiske....


                         +         -         -         -         -         *         -:210
query           SPGYSQLWRQYAKILSQRNSLLKEIRDHRSKQEVLEVWDEQLYRYGAKVIYLRLQVLKKLIPIARKTHFG
PF02463         ......................................................................


                         -         -         -         +         -         -         -:280
query           LTGGTEELQAKYLSSLVLEPGLSEGQIYQVFSSSSKKIRQMELKRCQTLLGPHRDDLSLAINGVEAKTFG
PF02463         ......................................................................


                         -         *         -         -         -         -         +:350
query           SQGQQRTVTLSLKLSQLDLWYHEFGEYPVLLLDDVLFELDRSRQNMLIDKILNKVQTFITTSFTGGIEET
PF02463         .................lLSgGektLvalaLlfA.....iqkvkpaplyllDeidaaLDekn--------


                         -         -         -         -         *         -         -:420
query           IKGAGLLWQVNAGSLTQKEEF-------------------------------------------------
PF02463         ----------------------------------------------------------------------