[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for dred0:ABO48569.1


[Show Plain Result]

## Summary of Sequence Search
   1::151
   3::100  PF00383 0.0% 40.2061855670103  Cytidine and deoxycytidylate deaminase zinc-binding 
  47::93   PF08210 0.0% 29.7872340425532  APOBEC-like N-terminal domain 
   1::151


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSHALFMREALIEAQKAAVKGEVPIGAVVVWKDEVIGRGYDLRESLCDASAHAEILAMRKAAKHLGDWRL
PF00383         --deklleialeaakeaykcsnfkvGavivkkngeiistgyngepaggsktiHAEvnAilsaakn.ggsk
PF08210         ----------------------------------------------nekkaHaEllfleliksskllead


                         -         -         *         -         -         -         -:140
query           NDATLYVTVEPCAMCAGAIVQFRINRLVYGAPNAKSGSVDTILNIVQEARFNHRVEVIAGILEDQCKEII
PF00383         legatlyvtlePCgmCakaiiesgikkvvi----------------------------------------
PF08210         qeyevtwyvswsPCleCaekvae-----------------------------------------------


                         +         -         -         -         -         *         -:210
query           QNFFRELRKNK-----------------------------------------------------------
PF00383         ----------------------------------------------------------------------
PF08210         ----------------------------------------------------------------------