[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for dred0:ABO48689.1


[Show Plain Result]

## Summary of Sequence Search
   1::334
 226::241  PF00037 0.0% 62.5  4Fe-4S binding domain 
 302::320  PF00037 0.0% 42.1052631578947  4Fe-4S binding domain 
   1::334


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MILNKSETASLLDKLANEYRVIAPVEKEGLVQFAAIQKGEEAKLDYMNAKKPGKEILFPQSEELYSYTVD
PF00037         ----------------------------------------------------------------------
PF00037         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           AEGVRMQDNVDPKATIVFGMRPCDVKSMVLLDNVFKNDQYEDVYYLTRRANTLIVGLGCNEPSATCFCSS
PF00037         ----------------------------------------------------------------------
PF00037         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           MSCGPFAKEGSDIFLTDIGEAYVVEGISEKGKELLAKLGLAEASAEAKGQAAKLQEETKADGSVNIEGLA
PF00037         ----------------------------------------------------------------------
PF00037         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           EKLGGMFEHPYWDSLYEKCLGCGACTYLCPTCHCFDIADEATDCNGCRVRNWDACMFPLFTLHGSGHNPR
PF00037         ---------------eekCigCGaCvevCPv---------------------------------------
PF00037         ---------------eekCigCGaCvevCPv---------------------------------------


                         -         *         -         -         -         -         +:350
query           PGGKARWRQRLMHKFNYFVERYNATACVGCGRCIKNCPVNLDIRQVLADVRALD----------------
PF00037         ---------------------ideekCigCGaCvevCPvg------------------------------
PF00037         ---------------------ideekCigCGaCvevCPvg------------------------------