[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for dred0:ABO48707.1


[Show Plain Result]

## Summary of Sequence Search
   1::472
  16::133  PF01743 0.0% 39.4495412844037  Poly A polymerase head domain 
 235::382  PF01966 0.0% 23.2142857142857  HD domain 
   1::472


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSTISMLSQQLSIQTYLVGGAVRDLFLNKIPVDLDFCVTAKVFALAQTLTQQYQGSLVTLDDQREMLRVV
PF01743         ---------------ylvGGaVRDllLgkevkDvDlavdaapeevakefakkvkealls.gkefqtiavl
PF01966         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           TNSWHLDFSPLRDEILEKDLFARDFTLNAMALPVSMGINKYNWQNQIQDPTGGKGDLKKGLLRAASSSSI
PF01743         lkkqtlevatfrtekkesdarnpksekftesleeDlkrRDfTiNalayn........lekgkv-------
PF01966         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           QQDPLRSLRGIRFAATYNLAIIPETMVLLRQGTRRIEQIAGERLWHELAILFKLPITSFWINYMDQELHF
PF01743         ----------------------------------------------------------------------
PF01966         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           WQYLLPGQLRMAQTKQNHYHVENVWRHCLRTYECLEVILQELSTIPSEGEPLLIHFNQHLSGGRSRCQVL
PF01743         ----------------------------------------------------------------------
PF01966         ------------------------leHsleVaklarrlaedlge...................eedrell


                         -         *         -         -         -         -         +:350
query           KLAALIHDVGKPDTAVIREDGRISFHGHAEAGVPYAEALATRLKLSRLERHYLVNLVLLHMLPLNLYNSG
PF01743         ----------------------------------------------------------------------
PF01966         rlaaLlHDiGkgpfgdsfekkee....fkaHekvgaeilrevekrlgld...ledvaklirehheswege


                         -         -         -         -         *         -         -:420
query           DRSDLSVYRLFRSLENYILDVLILSLADVTATLTAGERISELEAYRTFILNLLGKFIVEKDRFHPVPYLS
PF01743         ----------------------------------------------------------------------
PF01966         k....ype......glaereislearivklaD--------------------------------------


                         -         -         +         -         -         -         -:490
query           GAALLELGIPEGPEVGLILEKLCEEQVTGSITDTKTALLWVKTKLAGNNKDK------------------
PF01743         ----------------------------------------------------------------------
PF01966         ----------------------------------------------------------------------