[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for dred0:ABO48823.1


[Show Plain Result]

## Summary of Sequence Search
   1::396
  26::343  PF00202 0.0% 48.4276729559748  Aminotransferase class-III 
   1::396


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNNQEILAMGQQYVMNTYGRLPMALVKGQGAWVWDADGRQYLDFVSGIAVNCLGHAHPEVAEAVCKQVKT
PF00202         -------------------------tkakGvyltdvdGrrylDflsgiavvnlGhahpkiveavkeqadk


                         -         -         *         -         -         -         -:140
query           LLHCSNIYWIEPQVKLAKLLVENSCADKAFFCNSGAEANEGAIKLARKYAKQHLGPDKYEIITATNSFHG
PF00202         lshvsfralttepalklaeklaeltPkgldkvflansGseanetAlKlarayekkkgatektkiiafega


                         +         -         -         -         -         *         -:210
query           RTLATVTATGQTKYQRGLDPLPQGFAYVPFNDLEALKNTIGPHTCAVMLEPVQGEGGVIPAAQAYLEGVK
PF00202         fhGrtlgalsvtkskkykklfgpllpgveilpypdlkaaeeekalleeaerlikevkkeeiaAvivEPiq


                         -         -         -         +         -         -         -:280
query           QLCEEKGLLLIFDEVQCGLGRTGKFLGYQHYGVEPDIITLAKALGGGFPIGAMLAKEQVAQAFQPGDHAS
PF00202         gegGvvvaseeflaklreickkhnvllivDEvqtGfGrtGklfAaehagvepDlmtlaKaltgGlplsav


                         -         *         -         -         -         -         +:350
query           TFGGNPLAATASLATMETLLQKGVLENAWQMGEYFKAELTKLAAEVPLVKEVRGLGLMIGLELGIEGKDI
PF00202         lataevmqafqpgshgttfggnplacavalavlevieeeellenaqekgerlkkgLeeLkeky-------


                         -         -         -         -         *         -         -:420
query           VAHCLEQGLLINCTNGNVLRFLPPLIITKDEIDQAVQILKRAMLVV------------------------
PF00202         ----------------------------------------------------------------------