[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for dred0:ABO48876.1


[Show Plain Result]

## Summary of Sequence Search
   1::151
  15::137  PF00892 0.0% 29.5081967213115  EamA-like transporter family 
  46::137  PF08449 0.0% 17.7777777777778  UAA transporter family 
   1::151


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSAKRVYILMVLAALFWSGAFITGKLAVREFPPFALTFFRFSFALPFVLWEKPLTYLPNATTEGWLAILY
PF00892         --------------lswaiyfvlskkllesvspltitayrlliagillilllfllrep.ialislkdila
PF08449         ---------------------------------------------ktgelasavsfllkhps..vlfyll


                         -         -         *         -         -         -         -:140
query           MAVFASVLGYLFQLIAIQNIGAPKAAIFINLVPVFTIMQSLLFLGEPFSWFKMLSACIIVTGVYLTTRPE
PF00892         llllgllgtvlgyllffyalkktsasnaslitslePvftillsvlllgekltlkqllgivlillGvl---
PF08449         lnsltqyvgikfvflliaefgaltvtlvttlRKfvslllSvllFgnpltlqqwlGtllVflgillka---


                         +         -         -         -         -         *         -:210
query           SGVKEAAGIKA-----------------------------------------------------------
PF00892         ----------------------------------------------------------------------
PF08449         ----------------------------------------------------------------------