[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for dred0:ABO49029.1


[Show Plain Result]

## Summary of Sequence Search
   1::128
   7::50   PF07561 0.0% 47.5  Domain of Unknown Function (DUF1540) 
  86::125  PF07561 0.0% 52.5  Domain of Unknown Function (DUF1540) 
   1::128


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MHKSPRVLCEVNTCTHWLLGNLCTAANIDILYEEEGKMAQKDAHTECKTFYKKNGITSYLGSMDNVNWGG
PF07561         ------vkCsVsnCkywnegnlCtAdkIeVegde....assseeTcCkTF--------------------
PF07561         ------vkCsVsnCkywnegnlCtAdkIeVegde....assseeTcCkTF--------------------


                         -         -         *         -         -         -         -:140
query           LVSGSFREGQQITPAVVCIVESCKYWAKGNLCEAETIQVSGQNANECQDTNCKTFEEK------------
PF07561         ---------------vkCsVsnCkywnegnlCtAdkIeVegdeassseeTcCkTF---------------
PF07561         ---------------vkCsVsnCkywnegnlCtAdkIeVegdeassseeTcCkTF---------------