[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for dred0:ABO49033.1


[Show Plain Result]

## Summary of Sequence Search
   1::153
   4::153  PF01862 0.0% 42.6666666666667  Pyruvoyl-dependent arginine decarboxylase (PvlArgDC 
   1::153


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLPTPKKYFVTAASSEGKSKLTAFDNALLKARIGNVNLLRVSSILPPGCQEDPGMVLPPGSLVPTAYGYI
PF01862         ---ipkkvfvtkGvGeskdklasFdlALrdAgIenfNLvkvSSilPpeaeiisreeglkelkpGeivftv


                         -         -         *         -         -         -         -:140
query           VSNVPGEIISACVGVGINSNDSFGVIMEFSGKCSKEEAEQNITNMVKEAFETRGMELKDIKIASAEHKVE
PF01862         marassnepgrliaaavGvaipkdkkkfGyisEyhafgekeeeaeeiaeklakemletrlkklsekiket


                         +         -         -         -         -         *         -:210
query           KIGCALAAVPLWY---------------------------------------------------------
PF01862         klitkeaevdkkg---------------------------------------------------------