[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for dred0:ABO49055.1


[Show Plain Result]

## Summary of Sequence Search
   1::72
   3::69   PF11148 0.0% 53.7313432835821  Protein of unknown function (DUF2922) 
   1::72


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTKTLELIFVNVAGDKVTLRVNDPRDDLQEAEVRTVMDTVVAKNVFTSTGGSLTGVAGARLVTRDVAELN
PF11148         --ktLeLtFktaegktvtlslpdpkedlteaevkaaMdtiiakniftskggdlvevksAriVettttel-


                         -         -         *         -         -         -         -:140
query           IL--------------------------------------------------------------------
PF11148         ----------------------------------------------------------------------