[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for dred0:ABO49099.1


[Show Plain Result]

## Summary of Sequence Search
   1::128
  14::119  PF08859 0.0% 42.4528301886792  DGC domain 
   1::128


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSNCDCGCSSAPVLFFSCSGGSNVGQIANDVCRQLTMDGQGKLFCLAGVGGKIGSFVEKAKDGSKVIVID
PF08859         -------------lvfsCsGasnvGqlareaavklakegaaeliClagvaagveelvklarsarriiaid


                         -         -         *         -         -         -         -:140
query           GCNLHCARKILENADIPINTHIVLTDLGVAKNNNLINEQTVIHENKVKILQIIMENNK------------
PF08859         GCalnCakkileeagvkvdkeivltdlgikkkkeedlseeeieavaekv---------------------