[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for dred0:ABO49162.1


[Show Plain Result]

## Summary of Sequence Search
   1::206
   5::81   PF03458 0.0% 45.4545454545455  UPF0126 domain 
  90::167  PF03458 0.0% 47.4358974358974  UPF0126 domain 
   1::206


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTLLSLLDMIGTFAFALTGALVAVRKEMDLYGILLLSFVTAIGGGTTRDLLLGNTPVFFLNQPSYFYISL
PF03458         ----llldaiGlaafavsGalkalrkgldlfgvvvlgvvTavgGGilRDvllgeiPvvlrkdeiyalaal
PF03458         ----llldaiGlaafavsGalkalrkgldlfgvvvlgvvTavgGGilRDvllgeiPvvlrkdeiyalaal


                         -         -         *         -         -         -         -:140
query           LAGFCTFLFHKELFKINSIILILDALGLGLFVCVGVSIALSAHISFTGAVILGVVTGTVGGIIRDLLAGE
PF03458         lgalivvllar--------lllldaiGlaafavsGalkalrkgldlfgvvvlgvvTavgGGilRDvllge
PF03458         lgalivvllar--------lllldaiGlaafavsGalkalrkgldlfgvvvlgvvTavgGGilRDvllge


                         +         -         -         -         -         *         -:210
query           IPTVLVKDFYALICVVGGILYVYLHHLNVPHDITLLVSASVIFFLRLAAIKLKWNFVKASRSSLLQ----
PF03458         iPvvlrkdeiyalaallgalivvllar-------------------------------------------
PF03458         iPvvlrkdeiyalaallgalivvllar-------------------------------------------