[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for dred0:ABO49306.1


[Show Plain Result]

## Summary of Sequence Search
   1::343
  13::335  PF01594 0.0% 31.7757009345794  Domain of unknown function DUF20 
   1::343


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAWWKEKCTYRYLFLSFLIGLILFFLYLIRGLFVPFILAIVLVYMLNPLVERMEKRGSPRVVAILILYLG
PF01594         ------------llilillllilafiwfistllvpllialvlayllnpvvkfLkkrgvkrslaillvlll


                         -         -         *         -         -         -         -:140
query           VVIVATSLLMYGVPRMVNQLEKMVENIPLYTDQVEEIVRNIQKRFADSSMPPGVQQIVDERIRWVESRVL
PF01594         llvllvlllvllvplliaqltqlvkslpqyidslqnllnelpesleele.l.likalesslskvlsnils


                         +         -         -         -         -         *         -:210
query           AIVRKSMDLLMALLSNLFYIALAPVLAFYIMKDLKLIKNWTRSIVPKELVEDVFYLARKVDDVFSNFIRG
PF01594         silssllsllasllklllqlilvllllffflldgeklrqgilsllpkrvrervdailselkktlsgylkg


                         -         -         -         +         -         -         -:280
query           HLTVVVIVGILSSLAFMVIGLEFAAMFGIIAGIAELIPYFGPLIGAAPAVGIALLHSKYMTLKVILAVLI
PF01594         qvivaliigvlvfigllllgvpyalllallvglanlIPyiGaviilipiaiillltggikallivlivvl


                         -         *         -         -         -         -         +:350
query           IQQVEGNIISPKIMGNCMGLHPLVIIVALLAGGHLFGIAGMLLAVPLAAIIKIIVSFVWRKLI-------
PF01594         lvqliednilePklmgkrlklhplvillsliaggslfGlvGlilgppllavlkal---------------