[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for dred0:ABO49466.1


[Show Plain Result]

## Summary of Sequence Search
   1::263
  60::87   PF03622 0.0% 57.1428571428571  IBV 3B protein 
 113::143  PF03622 0.0% 25.8064516129032  IBV 3B protein 
   1::263


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKEMTLLLVVFIFILLLLGAAMVMIWYLNRGKDKSVQNSIEFSHESEEVLEITHKKPDKNYQHISELINT
PF03622         -----------------------------------------------------------nLqhissvlnt
PF03622         -----------------------------------------------------------nLqhissvlnt


                         -         -         *         -         -         -         -:140
query           EVVEPGIYYTGGKYLGLARIEGTNFSILSDGEIEAREDMLIAIQNQIKYPVQYITSTIVTDTDREVEKIQ
PF03622         evfDPfevCyYrgGsyw-------------------------viqqisfnLqhissvlntevfDPfevCy
PF03622         evfDPfevCyYrgGsyw-------------------------viqqisfnLqhissvlntevfDPfevCy


                         +         -         -         -         -         *         -:210
query           YHAGKTTNHKVSLYCKQYIMELENMKQERRAMAKVSWLVISGDDKLGAPGNPVQRIKERMALLQETFRSR
PF03622         Yrg-------------------------------------------------------------------
PF03622         Yrg-------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           AGIIMTPLTSTEEVVDAFQQIMQPEKLVKPSEVARLCMHPIKFNIKEIADIAT-----------------
PF03622         ----------------------------------------------------------------------
PF03622         ----------------------------------------------------------------------