[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for dred0:ABO49533.1


[Show Plain Result]

## Summary of Sequence Search
   1::2558
  42::321  PF03534 0.0% 41.025641025641  Salmonella virulence plasmid 65kDa B protein 
 411::437  PF12256 0.0% 25  Insecticide toxin TcdB middle/N-terminal region 
 517::539  PF12256 0.0% 43.4782608695652  Insecticide toxin TcdB middle/N-terminal region 
 624::647  PF12256 0.0% 40.9090909090909  Insecticide toxin TcdB middle/N-terminal region 
 654::838  PF12256 0.0% 46.0122699386503  Insecticide toxin TcdB middle/N-terminal region 
 886::1020 PF12255 0.0% 44.7761194029851  Insecticide toxin TcdB middle/C-terminal region 
1773::1800 PF05593 0.0% 39.2857142857143  RHS Repeat 
1821::1843 PF05593 0.0% 30.4347826086957  RHS Repeat 
1874::1891 PF05593 0.0% 44.4444444444444  RHS Repeat 
1959::1971 PF05593 0.0% 53.8461538461538  RHS Repeat 
   1::2558


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MGNKIKSFTNQKDKSKISFTELSLPKGGGAIKGIGETFQPDPFSGTANLSIPVQMSPCRDFEPKISLNYN
PF03534         -----------------------------------------gadGaaslslpLpisagRglapalaLsYs
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           SGTGNGIFGIGFSISIPNISRKTEKGIPRYNDTDTFLFSNAEDLVSKMVKNQEGSWVKEERHVEENRVGW
PF03534         sgaGNgpfglGwqlsvmaisrrtskGvPkYaeedeflgpdgevlvpvl..deegkvekeeatalkglele
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           KVLSYIPRIEGLFAQIEYWQNSWESFWKVTTKDNTTSIYGQSENARIADPHDNTRVFKWLIEKTYDAKGN
PF03534         qeytvtryqprvegkfsrlErwqpkseaeeaFWliasadgqlhllGktaeariadpaapervaeWllees
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           KIEYFYKQEDNENAPDNICEKNRTYATNKYVSSIKYGNYLDGKGEEAWAFEVVFDYGQYDISDQYLSQPG
PF03534         vsptgehivYqYkaedeegvdedeaeahasasaqrylkqvrYgnlkasaalyllksaapeeeewlfelvf
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           CNPYIPARKWPARQDPFSSYRSGFEIRTLRLCRNILMFHHFKKELGETPCLVKATQLTYREPAQQLQNSN
PF03534         dyGeressle..kvpelka...seeWkvRqDpfsryeyGFe-----------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           NPFTKILQLSQVELKGFKRKENGSYQFRSMPSLKLTYSCLMPAGGKFDTLKVGNSTAVPVSTGQIRYNFV
PF03534         ----------------------------------------------------------------------
PF12256         ------------------------------------------------------------d...cqlsla
PF12256         ------------------------------------------------------------d...cqlsla
PF12256         ------------------------------------------------------------d...cqlsla
PF12256         ------------------------------------------------------------d...cqlsla
PF12255         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           DLYGDGIPGLLYSDDKATLYWKPKGNGEYEYPEPAAQFPIEKDLKKGEYTLVSLEGNGRLDLVVGTPQRG
PF03534         ----------------------------------------------------------------------
PF12256         DinGdGladlvlsvphi-----------------------------------------------------
PF12256         DinGdGladlvlsvphi-----------------------------------------------------
PF12256         DinGdGladlvlsvphi-----------------------------------------------------
PF12256         DinGdGladlvlsvphi-----------------------------------------------------
PF12255         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           GFYEGNPDGSWHSYRDFATYPLDFTNSHKEMIDMNGDGLADLLLYEDNTAKIYPSLKKKGYGIPTRASLS
PF03534         ----------------------------------------------------------------------
PF12256         --------------------------ydcqlslaDinGdGladlvlsvp---------------------
PF12256         --------------------------ydcqlslaDinGdGladlvlsvp---------------------
PF12256         --------------------------ydcqlslaDinGdGladlvlsvp---------------------
PF12256         --------------------------ydcqlslaDinGdGladlvlsvp---------------------
PF12255         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           EDYPTTSNGYAEEVLSYADMFGDGMAHRVRIRNGSVECWPNLGHGRFGKRVLFANAPRFGDTLDASRLFL
PF03534         ----------------------------------------------------------------------
PF12256         ---------------------------------------------------------------d.cqlsl
PF12256         ---------------------------------------------------------------d.cqlsl
PF12256         ---------------------------------------------------------------d.cqlsl
PF12256         ---------------------------------------------------------------d.cqlsl
PF12255         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           ADLDGTGMTDLIYAYPDKVQVFFNQGGNSFSPPLSIPLPETYSNLDQLGFADVKGNGTACLVFIKTGANA
PF03534         ----------------------------------------------------------------------
PF12256         aDinGdGladlvl.svp------nqsgnsfasepltlplptgvrydcqlslaDinGdGladlvlsvphik
PF12256         aDinGdGladlvl.svp------nqsgnsfasepltlplptgvrydcqlslaDinGdGladlvlsvphik
PF12256         aDinGdGladlvl.svp------nqsgnsfasepltlplptgvrydcqlslaDinGdGladlvlsvphik
PF12256         aDinGdGladlvl.svp------nqsgnsfasepltlplptgvrydcqlslaDinGdGladlvlsvphik
PF12255         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:770
query           KQYYYDFSEGTKPYLLTGIDNNLGALTNIKYTSSVKYYLHDKMAGKPWKTKLPFPVQVVEKVESIDKISG
PF03534         ----------------------------------------------------------------------
PF12256         ekaprhwrldfete..pylLksitnnlGasttleYassaqywlddkaaatakgstlpqsslpfpvhvvsr
PF12256         ekaprhwrldfete..pylLksitnnlGasttleYassaqywlddkaaatakgstlpqsslpfpvhvvsr
PF12256         ekaprhwrldfete..pylLksitnnlGasttleYassaqywlddkaaatakgstlpqsslpfpvhvvsr
PF12256         ekaprhwrldfete..pylLksitnnlGasttleYassaqywlddkaaatakgstlpqsslpfpvhvvsr
PF12255         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:840
query           LKLTTQYKYHDGFYDSVEREFRGFGFVEETDSEDFFTYAKPGLLENVAFYGLEEEHHVPPVLTKRWYHIG
PF03534         ----------------------------------------------------------------------
PF12256         vtiddgitgntltttyrYeggvydgkereflGFgrveqtdldst....................aetp--
PF12256         vtiddgitgntltttyrYeggvydgkereflGFgrveqtdldst....................aetp--
PF12256         vtiddgitgntltttyrYeggvydgkereflGFgrveqtdldst....................aetp--
PF12256         vtiddgitgntltttyrYeggvydgkereflGFgrveqtdldst....................aetp--
PF12255         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:910
query           ACIEEGVVSKQCEKEYYQQDKRGFSIPDSTFDDVVRQGCAETLRQAYRALKGQVIREEVYALDYIEGRTG
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ---------------------------------------------larAlkgqvlRsEvYglDgs.eraa
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:980
query           HPYTVTETNFHVRLIQPLIGENRAVFSVYKKETVSFNYERNPNDPQIQHEFILAVDDFGNVKKSCRVFYP
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         kPYtVtetryqvrllqaaaanrkavalvlplEslsyhYEriaqDPqvsqavvlevdeYGnvlksvsiayp
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:1050
query           RRATPKDAVSVVHPEQTKIKAIVDLHSFINNSLDFWLLGISYESKTLEIGALDLQGQACFSFTKIKDQVG
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         Rraspadnpypdtlpealltssldeqqqklrltetqasvh------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:1120
query           RALQNCIRNDEKFSSDKVQARLLSWERNYFWNEAQDAPLPLGQITDKALLHHSEEAVFSQELLNTVFNGK
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:1190
query           ATIDMLEKEGGYAFQEGYWWNRGLVQHYLKDRFLLPWKTENSYTSFPSSLYAKAVYEYDQYSLAPVKATK
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:1260
query           FITDKITNTSSALLDYTILLPVQITDINDNVSQAFFDPLGMVIATSVFGTMGGKPAGDRDLKEYKAIPQV
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:1330
query           DTTFDDVLANPHKYLQDATTYFYYDLSAWKNKGQPARSVQLTRETHVSDLAAGEKSGMHIQINYSDGFGR
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:1400
query           EIEKKLKADAGEAVLRDNAGKPVYDAAGKIVKDFAQDRWIVSGRTVYNNKAKPIKQFIPYFSATPDYELQ
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:1470
query           KDIDPILPKPTIIYYDPLLRVVKTVNPKGFFSKVEFTPWEEKHFDENDTVRDSVYFKNFKETYSKDPSQE
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:1540
query           QRDEKDALDKASRSYNTPDTKVLDNTGQTFLEIRNNLGEITKDILQDIVKGTEVNCQELWDELKSKGYIE
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:1610
query           TGDPPSAMGWVSGKFRPYFKGFMLGLDGRYKQFEEKIINLLKENCLTTYHELDIQGNVLFSVDPRLYYSN
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:1680
query           LKDHTDYYNFKYVYDMQKKPLSVDSADAGLKLSLSNIFGNTVHSWDSRGFHTRKMYDSLQRCVQIGVEGN
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:1750
query           DGRGLVLHQAVEKFVYGEFYEEKEEASKDKNLRGQVYKHFDQAGVVTCNLYNLKGKAVQTDRQFLADYKK
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:1820
query           EANWDNVNKSSLADELFSIGCSYDALERVISETAPDGSIYTHIYNQAGLLRKVVVAFKDGSEEEFIKDIQ
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------
PF05593         ----------------------YDaaGrLtevtdatGrvttYtYDaaGrl--------------------
PF05593         ----------------------YDaaGrLtevtdatGrvttYtYDaaGrl--------------------
PF05593         ----------------------YDaaGrLtevtdatGrvttYtYDaaGrl--------------------
PF05593         ----------------------YDaaGrLtevtdatGrvttYtYDaaGrl--------------------


                         -         -         +         -         -         -         -:1890
query           YNANGQRLKIIYGNGVTTEYSYTDPALRLTDILSLKPDSNNTKDFKGCLLQKIHYTYDPVGNVTRLRDNS
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------
PF05593         YDaaGrLtevtdatGrvttYtYD------------------------------tYtYDaaGrlTaltdpd
PF05593         YDaaGrLtevtdatGrvttYtYD------------------------------tYtYDaaGrlTaltdpd
PF05593         YDaaGrLtevtdatGrvttYtYD------------------------------tYtYDaaGrlTaltdpd
PF05593         YDaaGrLtevtdatGrvttYtYD------------------------------tYtYDaaGrlTaltdpd


                         *         -         -         -         -         +         -:1960
query           YPTVFYNQQKVEPLSDYSYNPLYQLVSATGRQHPGIFDGSHRDGFKQSKFIPIKSSNPNDGTSLENYRQD
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------
PF05593         G-------------------------------------------------------------------tt
PF05593         G-------------------------------------------------------------------tt
PF05593         G-------------------------------------------------------------------tt
PF05593         G-------------------------------------------------------------------tt


                         -         -         -         *         -         -         -:2030
query           YQYDEAGNLTNIRHISSSTSWTRQLDISKGTNRTVQIASLNGAKNFFKTAYDPCGNMLNLENLASINWSY
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------
PF05593         YtYDaaGrlTa-----------------------------------------------------------
PF05593         YtYDaaGrlTa-----------------------------------------------------------
PF05593         YtYDaaGrlTa-----------------------------------------------------------
PF05593         YtYDaaGrlTa-----------------------------------------------------------


                         -         +         -         -         -         -         *:2100
query           RNNLSRVDVILRENNSSDSEYFIYDSSGQRVRKVSERKCGSLREIEEKLYLGNFEIKRIKKKSDHLESQI
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------


                         -         -         -         -         +         -         -:2170
query           LDRQSLHIMDGKSRIAITDIWLKDDLNRETEKTMERKFRYQLNNNLGSACLEVDEKVNIISCEEYFPYGG
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:2240
query           TSFIAGRDKREVKLKEYRYCGKERDDSTGFYYYGARYYLPWLGRWINPDPAGTVDGLNLYSFVKGNPVNF
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:2310
query           IDTSGKVGGSWLHLLYGGLTALAVGLIGGAAVGTGDYASPVVAALAGLAGMLFNKDKSALGALAIAGAGA
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:2380
query           IGSAVGGYVGRGTMSKLKEKDWQTTSVARTGLVASGLTGGTIGSLGVLAVQAVTRQFNTHNILMGAIAGF
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:2450
query           GGGILASGAQFGLFKPGDAKVPTMPVRAELKDLLPYQTRAFDRHYLELNPNPEELITNLKPKHFTVIDEE
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:2520
query           TQQRVKCDLVAVHGYPRFSFVQSVHGDYNQYIDKEKLVQLLQQAGFPHQDSTTGKNIPIKLATCFGGFWE
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:2590
query           SWFSTAQLVADKLGTEVYAHRWPVTVAQQSPWKKFTPN--------------------------------
PF03534         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12256         ----------------------------------------------------------------------
PF12255         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------
PF05593         ----------------------------------------------------------------------