[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for dred0:ABO49594.1


[Show Plain Result]

## Summary of Sequence Search
   1::128
   2::58   PF06686 0.0% 35.0877192982456  Stage III sporulation protein AC/AD protein family 
  70::126  PF06686 0.0% 45.6140350877193  Stage III sporulation protein AC/AD protein family 
   1::128


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MDILQIVGLGLVVCILAIILRQQKPPMATLLTMTAGIIIFFAMMSQITAVFNVLRDLASQANVSMVYMGT
PF06686         -eIlkIvgiaiiaaflalilkdagkeeiAvlielaggiiIlllvipkitalfetikel-----------e
PF06686         -eIlkIvgiaiiaaflalilkdagkeeiAvlielaggiiIlllvipkitalfetikel-----------e


                         -         -         *         -         -         -         -:140
query           ILKIVGIAYIADFGSQICRDAGESALASKIEFAAKIIVLVMAVPIIVAVLQSLIKLVP------------
PF06686         IlkIvgiaiiaaflalilkdagkeeiAvlielaggiiIlllvipkitalfetikel--------------
PF06686         IlkIvgiaiiaaflalilkdagkeeiAvlielaggiiIlllvipkitalfetikel--------------