[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for dred0:ABO49673.1


[Show Plain Result]

## Summary of Sequence Search
   1::578
 469::574  PF02518 0.0% 41.3461538461538  Histidine kinase-, DNA gyrase B-, and HSP90-like AT 
 362::423  PF00512 0.0% 36.6666666666667  His Kinase A (phosphoacceptor) domain 
 240::347  PF08448 0.0% 27.1028037383178  PAS fold 
 239::341  PF00989 0.0% 19.4174757281553  PAS fold 
   1::578


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MIDRLISVPHLNQLVLYSIWEKFINGQRIETKDLFSETYKAWLRCVEYRINPYQITTESLSEEELSYRKS
PF02518         ----------------------------------------------------------------------
PF00512         ----------------------------------------------------------------------
PF08448         ----------------------------------------------------------------------
PF00989         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           KLTDMLELLTPHIETIKTTLSTHSDTFLILITDHEGFILESFTGKDSTKDLINVPYAPGIGYAEHLAGNN
PF02518         ----------------------------------------------------------------------
PF00512         ----------------------------------------------------------------------
PF08448         ----------------------------------------------------------------------
PF00989         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           GIGSVLATGIPLAVLGAEHFVKDFHRWSCVGSPIIGDKGDIIAVLGVFMPCGMESPYTFSLTVAATKAVE
PF02518         ----------------------------------------------------------------------
PF00512         ----------------------------------------------------------------------
PF08448         ----------------------------------------------------------------------
PF00989         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           AAIKQGQMEKQLQDTRKTLRNLMQQRNIIFNAMSQGVIILNHEGIVTFFNKAAEEIWHINADELVGRPFF
PF02518         ----------------------------------------------------------------------
PF00512         ----------------------------------------------------------------------
PF08448         -----------------------------ldslpdalavldpdgrvlyaNaaaaelfgappeellGktla
PF00989         ----------------------------ileslpdpifvvDedgrilyvNaaaeellGlsreevlgksll


                         -         *         -         -         -         -         +:350
query           CFSRCRRAEPLLIRSLKEANSFTNIECKCSNLLHEKYILVNISLLRDEKNAVSGAIGIYTDVTELRRQEA
PF02518         ----------------------------------------------------------------------
PF00512         ----------------------------------------------------------------------
PF08448         ellpeedaarleralrrvlegeepiefleelll.pgeerhyelrllPlrdesGevigvlvisrdiTe---
PF00989         dliheeddaelaelleqlleqgeesrageisfklrdgrpihlevraspvrdaggeilgflg---------


                         -         -         -         -         *         -         -:420
query           RIREQEKLAVVGQMAAGMAHEIRNPLTSVRGFAQLMSEKMAEEQNPYKEFMEIMIQEIDQADSFINNFLQ
PF02518         ----------------------------------------------------------------------
PF00512         -----------grflagvsHELrtPLtailgnaellervgelteee..lrealeiirdeaerlraliedl
PF08448         ----------------------------------------------------------------------
PF00989         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           LARPKPPKMQACSLNQLILNFIKIFESQAFLQGVKIGIDLGEIPTIVIDKDQIKQVLLNLCQNALQAMNM
PF02518         ------------------------------------------------dedrlrqivselvdNavkatee
PF00512         Ldl-------------------------------------------------------------------
PF08448         ----------------------------------------------------------------------
PF00989         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           QGTITIATRFHAAEKEVSLSVRDNGPGIPGDNIDKLGTPFFTTKDKGTGLGLSISYTIVDKHQGRIEVES
PF02518         sgeiev..rvkreegelvieVeDnGiGipeedlervfepffqtdddsrkvggtGlGlsivkklvellgge
PF00512         ----------------------------------------------------------------------
PF08448         ----------------------------------------------------------------------
PF00989         ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           TIDEGTCFKVYLPVYEQF----------------------------------------------------
PF02518         ieveskeggGttvt--------------------------------------------------------
PF00512         ----------------------------------------------------------------------
PF08448         ----------------------------------------------------------------------
PF00989         ----------------------------------------------------------------------