[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for dred0:ABO49675.1


[Show Plain Result]

## Summary of Sequence Search
   1::176
  11::36   PF07670 0.0% 19.2307692307692  Nucleoside recognition 
  47::141  PF07670 0.0% 10.5263157894737  Nucleoside recognition 
  11::86   PF03600 0.0% 22.3684210526316  Citrate transporter 
   1::176


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MYELINQISRWAIPVMLLFIPLLAFIKKVPVFETFVEGAEAGFSTAIKTIPFLTAMLVAVSIFRASGAME
PF07670         ----------kagpiillasiliwllsslsllgrig----------lkagpiillasiliwllsslsllg
PF07670         ----------kagpiillasiliwllsslsllgrig----------lkagpiillasiliwllsslsllg
PF03600         ----------vplwialligillalllnykdlkeqlerleahagvalsvllliaaafvfvgvlqktgmfd


                         -         -         *         -         -         -         -:140
query           LLASWISPVLNMVGIPADILPHAVMRPLSGGAALGIATEIIKTHGPDSFVGRLVSTMQGSSDTTFYVLTL
PF07670         rigkllepvfaplgldwkasvglitgllakevvvgtlgtlytlggamlegfltpreaialllfvllytpc
PF07670         rigkllepvfaplgldwkasvglitgllakevvvgtlgtlytlggamlegfltpreaialllfvllytpc
PF03600         alaellvnvlkalipe------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           YFGSVGIRKYRYAVASGLTADFTTLIASIMICKLMF----------------------------------
PF07670         v---------------------------------------------------------------------
PF07670         v---------------------------------------------------------------------
PF03600         ----------------------------------------------------------------------