[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for dred0:ABO49703.1


[Show Plain Result]

## Summary of Sequence Search
   1::415
   3::278  PF00171 0.0% 22.7450980392157  Aldehyde dehydrogenase family 
 303::371  PF00171 0.0% 20.2898550724638  Aldehyde dehydrogenase family 
   1::415


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSNVKNLAKKAKIAARTLSVLDTEAKNSALEAIASQLLADKETILQANGKDLDNGKKMGLSPSLLDRLAL
PF00171         --dvdaavaaAkaafkawaklpaeeRaeilrkaadlleerrdelaelev..letGkpla..........e
PF00171         --dvdaavaaAkaafkawaklpaeeRaeilrkaadlleerrdelaelev..letGkpla..........e


                         -         -         *         -         -         -         -:140
query           TSARIDGMVEGIKQVVELEDPVGQVMETWQRPNGLEIAKVRVPMGVIGMVYEARPNVTVDTCALCLKAGS
PF00171         araevaeaidvlryyagaaeklegevlps.s..egkkalvrrePlGvvaaitPWNfPlllaawklapala
PF00171         araevaeaidvlryyagaaeklegevlps.s..egkkalvrrePlGvvaaitPWNfPlllaawklapala


                         +         -         -         -         -         *         -:210
query           AVVLRGSSSALNSNRALVSAIKKGLAKTAIPEDTVQFVDSEDRGAVDEMLRLNGLLDLVIPRGGAGLIRR
PF00171         aGNtvvlKpseetpltalllaelleea....glPkgvlnvvtgsgsevgealve.hpdvdkvsftGstev
PF00171         aGNtvvlKpseetpltalllaelleea....glPkgvlnvvtgsgsevgealve.hpdvdkvsftGstev


                         -         -         -         +         -         -         -:280
query           VVENATVPVIETGVGNCHVYVDVDADPGMALEILLNAKCQRYGVCNAAESLLVHEGIAANWLPGAVQELN
PF00171         grkiakaaaknlkkvtlElG.GkspliVledaDldkaveaivkgaflnaGQvCiatsrllVhesiyde--
PF00171         grkiakaaaknlkkvtlElG.GkspliVledaDldkaveaivkgaflnaGQvCiatsrllVhesiyde--


                         -         *         -         -         -         -         +:350
query           TRGVEIRGCSKVVEILSGVKKAEDSDWATEFLSPVLAIKVVKDFQDALDHIQQYSSGHSESIVTNNQNTA
PF00171         ----------------------dmriaqeEiFGPVlsvikfkdeeeaielaNdteyGLaaavftedlera
PF00171         ----------------------dmriaqeEiFGPVlsvikfkdeeeaielaNdteyGLaaavftedlera


                         -         -         -         -         *         -         -:420
query           AEFLRQVDAAAVYHNASTRFTDGFEYGFGAEIGISTQKLHARGPMGLRELTSYKYVVKGTGQVRP-----
PF00171         ervaerleaGnvwiNdsstgd-------------------------------------------------
PF00171         ervaerleaGnvwiNdsstgd-------------------------------------------------