[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for dred0:ABO49707.1


[Show Plain Result]

## Summary of Sequence Search
   1::298
  10::24   PF07885 0.0% 40  Ion channel 
 221::290  PF07885 0.0% 27.5862068965517  Ion channel 
   1::298


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTLQELFSSFAVVFVLLGTVLLFMHSFAPVTRSQERQITITLDVFHLFRHISVLLKYSLLSIAQMPPLLL
PF07885         ---------faivyiliGialfal----------------------------------------------
PF07885         ---------faivyiliGialfal----------------------------------------------


                         -         -         *         -         -         -         -:140
query           LFLILYGLVLSFYYWYQRMSLGLTGLLGLSILTTIISLGIIALILSPILFMTRKYLFDDMIESRIFRIAI
PF07885         ----------------------------------------------------------------------
PF07885         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           YSVMVPFLYIFIIHDLTPGPLVEGIMFTGIVISYYQIFRGIIYCLQTPRTFFSYLDSRFIPILMIVSWLF
PF07885         ----------------------------------------------------------------------
PF07885         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           VIIFNLYTMILLVSNTNPYSFIDSTGPVTEHIRLLYFTIITFTSVGYGDITPRGNFPVFITMIISITGFL
PF07885         ----------l............eeswekwsfldalYfsfvtltTiGYGdivpgtdagrlfaivyiliGi
PF07885         ----------l............eeswekwsfldalYfsfvtltTiGYGdivpgtdagrlfaivyiliGi


                         -         *         -         -         -         -         +:350
query           YSALFIGGLLAAFTSRSK----------------------------------------------------
PF07885         alfalvlavl------------------------------------------------------------
PF07885         alfalvlavl------------------------------------------------------------